Gene
| Gene Model ID | habu1_s878_g03165 |
|---|---|
| Locus | habu1_scaffold878 : 2705884 ... 2716010 : - |
| To GenomeBrowser | habu1_scaffold878:2705884..2716010 |
| Genes list of scaffold | habu1_scaffold878 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| insulin gene enhancer protein isl-2 | GO:0005634 GO:0006355 GO:0008270 GO:0021520 GO:0021524 GO:0031290 GO:0043565 GO:0045665 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s878_g03165.t1 | 1 | 1 | LIM | 1 | 41 | 4.9e-12 | 45.7 | 1.9e-15 | 9.2e-12 | 44.8 |
| habu1_s878_g03165.t1 | 1 | 1 | Homeobox | 95 | 150 | 3.0e-15 | 55.5 | 1.0e-18 | 5.1e-15 | 54.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s878_g03165.t1 | gi|558176612|ref|XP_006126302.1| | PREDICTED: insulin gene enhancer protein ISL-2 [Pelodiscus sinensis] | 0.0 |
| habu1_s878_g03165.t1 | gi|530650466|ref|XP_005311676.1| | PREDICTED: insulin gene enhancer protein ISL-2 [Chrysemys picta bellii] | 0.0 |
| habu1_s878_g03165.t1 | gi|591388024|ref|XP_007068425.1| | PREDICTED: insulin gene enhancer protein ISL-2 [Chelonia mydas] | 0.0 |
| habu1_s878_g03165.t1 | gi|154146254|ref|NP_081673.2| | insulin gene enhancer protein ISL-2 [Mus musculus] | 0.0 |
| habu1_s878_g03165.t1 | gi|589916609|ref|XP_006971624.1| | PREDICTED: insulin gene enhancer protein ISL-2 [Peromyscus maniculatus bairdii] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.1 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.2 |
| Nose | 1.9 |
| Brain-1 | 0.0 |
| Eye | 1.6 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.1 |
| Spleen | 0.0 |
| Lung | 0.0 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.6 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s878_g03165.t1 |
|---|---|
| Definition | - |
>habu1_s878_g03165.t1 gggcggcttcagcagcagcgacctggtcatgcgcgcccgcggccacgtctaccacctggagtgcttccgatgcgccgtct gcagccgccagctcctgcccggggacgagttctcgctgcgcgaccgcgagctgctctgccgcgccgaccaccgcctcctg ctggagggcgcctcctcggccgagagccccccgcgcagccccggacacctgcagggcgccaggccgggcccgctcccgct gccagacgcggtgcccgggcggcagccctcgctgcgttcccacgtgcacaagcaggcggagaagacgacccgggtgcgga cggtgctgaacgagaagcagcttcacacgctgcgcacctgctacgcggccaacccgcggccggacgcgctgatgaaggag cagctggtggagatgaccgggctgagcccacgcgtgatccgcgtctggttccagaacaagcgctgcaaagacaagaaaaa gtccatcctcatgaaacagctgcagcagcagcagcacagcgacaaggcaagtttgcagggcttaactgggacgcccttgg ttgctggcagccccatccgccacgacagcgccgtgcaaggcagcgcggtagaggtgcagacgtaccagcccccctggaaa gctctcagcaattttgctctgcagagcgacttggatcagcctgccttccagcaactgctctccatttctgaatccggctc cttaggcaactcatcgggcagcgacgtcacctctttatcgtcccagctccccgacacccccaacagcatggttcctagtc cagtggaaacgtgagagcgtcttttgaacgctgaccctcaaggacattcagcatgttttctttgcttcttgcatgagaac tgagcgctacggcaacacaacctgttaaattattc |
|
Protein
| Protein ID | habu1_s878_g03165.t1 |
|---|---|
| Definition | - |
>habu1_s878_g03165.t1 MRARGHVYHLECFRCAVCSRQLLPGDEFSLRDRELLCRADHRLLLEGASSAESPPRSPGHLQGARPGPLPLPDAVPGRQP SLRSHVHKQAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQ QQHSDKASLQGLTGTPLVAGSPIRHDSAVQGSAVEVQTYQPPWKALSNFALQSDLDQPAFQQLLSISESGSLGNSSGSDV TSLSSQLPDTPNSMVPSPVET |
|