Gene
| Gene Model ID | habu1_s889_g03250 |
|---|---|
| Locus | habu1_scaffold889 : 1390242 ... 1396294 : + |
| To GenomeBrowser | habu1_scaffold889:1390242..1396294 |
| Genes list of scaffold | habu1_scaffold889 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| sentrin-specific protease 8 | GO:0006508 GO:0008234 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s889_g03250.t1 | 1 | 1 | Peptidase_C48 | 74 | 206 | 4.9e-13 | 49.1 | 8.1e-17 | 1.2e-12 | 47.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s889_g03250.t1 | gi|602644122|ref|XP_007428515.1| | PREDICTED: sentrin-specific protease 8 isoform X1 [Python bivittatus] | 0.0 |
| habu1_s889_g03250.t1 | gi|557318360|ref|XP_006032372.1| | PREDICTED: sentrin-specific protease 8 [Alligator sinensis] | 0.0 |
| habu1_s889_g03250.t1 | gi|637353282|ref|XP_008118755.1| | PREDICTED: sentrin-specific protease 8 [Anolis carolinensis] | 0.0 |
| habu1_s889_g03250.t1 | gi|564240663|ref|XP_006277161.1| | PREDICTED: sentrin-specific protease 8 [Alligator mississippiensis] | 0.0 |
| habu1_s889_g03250.t1 | gi|530572974|ref|XP_005281036.1| | PREDICTED: sentrin-specific protease 8 [Chrysemys picta bellii] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 6.7 |
| Venom grand-1 | 8.1 |
| Pit, infrared sensing | 7.6 |
| Nose | 8.8 |
| Brain-1 | 10.1 |
| Eye | 5.5 |
| fetal fibroblast | 5.0 |
| venom gland-2 | 15.0 |
| Brain-2 | 10.2 |
| Spleen | 3.0 |
| Lung | 4.6 |
| Liver | 1.3 |
| Kidney | 4.1 |
| Pancreas | 3.4 |
| Small intestine | 3.9 |
| Large intestine | 3.3 |
| Stomach | 6.1 |
| heart | 3.3 |
| ovary | 75.8 |
| cheek muscle | 12.3 |
Transcript
| Transcript ID | habu1_s889_g03250.t1 |
|---|---|
| Definition | - |
>habu1_s889_g03250.t1 cggctgagggaggcgaggagcgcgaggcccggcggcaggctttgggctttctcccgcaggtgtagccctgcttgcgcaga atggaccctgttgtcctgagttacatggacagtttgctgagacaatcagatgtttctttactagatcctccctgctggct taacgaccacatcattgggtttgcctttgagtattttgccaacgaccagttccgagacgtctccgaccaggcctgcttcg tgggcccggaggtggctcagttcatcaaatgcaccaccaaccaggaggagctggccctgttccttgagcccctggacctg ttgcacaagaaaatggtgttcctggcgatcaacgacaactccaaccaagcggctggcggcacccactggagcttgctagt gtatttccaagacaagaactgctttgctcactacgactcccatagcaggtgtaactcagcgcatgccaaacaggtggcaa ggaatctgcagtccttccttggcaagaggggcaaagttgcctttgtggaagagaaggccccggcgcagcagaacagctat gactgtgggatgtatgtgatctgcaacactgaggccctgtgccgagaattcctcctccaagagcagcaggaaccagtgct tcagctcttgactccttcgttcatcacaggcaagagagaagaatggaaaaaactcattgctacgctctccgagaagtgac ttctttccagatattggtctttttttaaaaaaaaaaaaaatcttgttctctgtgcctaagaggagcacttgtgcacaaga ctttttttttttccctacaga |
|
Protein
| Protein ID | habu1_s889_g03250.t1 |
|---|---|
| Definition | - |
>habu1_s889_g03250.t1 MDPVVLSYMDSLLRQSDVSLLDPPCWLNDHIIGFAFEYFANDQFRDVSDQACFVGPEVAQFIKCTTNQEELALFLEPLDL LHKKMVFLAINDNSNQAAGGTHWSLLVYFQDKNCFAHYDSHSRCNSAHAKQVARNLQSFLGKRGKVAFVEEKAPAQQNSY DCGMYVICNTEALCREFLLQEQQEPVLQLLTPSFITGKREEWKKLIATLSEK |
|