Gene
| Gene Model ID | habu1_s9000_g19067 |
|---|---|
| Locus | habu1_scaffold9000 : 545184 ... 545770 : - |
| To GenomeBrowser | habu1_scaffold9000:545184..545770 |
| Genes list of scaffold | habu1_scaffold9000 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| low quality protein: type iii iodothyronine deiodinase | EC:1.97.1.10 GO:0004800 GO:0042446 GO:0055114 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s9000_g19067.t1 | 1 | 1 | T4_deiodinase | 14 | 150 | 1.2e-40 | 139.0 | 9.80909e-45 | 1.4e-40 | 138.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s9000_g19067.t1 | gi|699629684|ref|XP_009903393.1| | PREDICTED: LOW QUALITY PROTEIN: type III iodothyronine deiodinase [Picoides pubescens] | 0.0 |
| habu1_s9000_g19067.t1 | gi|701399672|ref|XP_009996306.1| | PREDICTED: LOW QUALITY PROTEIN: type III iodothyronine deiodinase [Chaetura pelagica] | 0.0 |
| habu1_s9000_g19067.t1 | gi|704190593|ref|XP_010138764.1| | PREDICTED: LOW QUALITY PROTEIN: type III iodothyronine deiodinase [Buceros rhinoceros silvestris] | 0.0 |
| habu1_s9000_g19067.t1 | gi|704260406|ref|XP_010150834.1| | PREDICTED: LOW QUALITY PROTEIN: type III iodothyronine deiodinase [Eurypyga helias] | 0.0 |
| habu1_s9000_g19067.t1 | gi|663280412|ref|XP_008498254.1| | PREDICTED: LOW QUALITY PROTEIN: type III iodothyronine deiodinase [Calypte anna] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 4.7 |
| Venom grand-1 | 11.8 |
| Pit, infrared sensing | 1.3 |
| Nose | 1.6 |
| Brain-1 | 0.5 |
| Eye | 2.6 |
| fetal fibroblast | 110.1 |
| venom gland-2 | 5.4 |
| Brain-2 | 0.0 |
| Spleen | 4.5 |
| Lung | 1.3 |
| Liver | 1.7 |
| Kidney | 1.8 |
| Pancreas | 1.5 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.1 |
| heart | 0.1 |
| ovary | 6.4 |
| cheek muscle | 0.3 |
Transcript
| Transcript ID | habu1_s9000_g19067.t1 |
|---|---|
| Definition | - |
>habu1_s9000_g19067.t1 gggaccacagcgtgggcgcccagcggagctgccactcctgccgcggcgatgctacactccgtgggcgcccagaccttgca agcgctcagccaggtggccgcctgcgtgctcctcctgccccgcttcctcctgaccgctgtgatgctctggctcctggatt ttctctgcatccggaagaaactcttgctgaccgcggcggcggcggcggcgacccttggcgaggagcaagagttggcggcg gaggacggcgactcgagcgaggggacctgcccgccggacgaccctccgctctgcgtctccgactcgaaccgcatgttcac gttggagtcgctcagagcggtgtggcacgggcagaagctggactttttcaaggcggcgcacgtcggcgcgacggcgccca acccggaggtcgtccagctggacgggcgcacgcggcagcgcatcctggactacgcccggggcaagaggccgctgatcctc aacttcggcagctgcacctgaccccccttcatggcgcgcctgcgcgccttcgagcgcctggccacgcgcttcgtggacat cgccgacttcttgctggtctacatcga |
|
Protein
| Protein ID | habu1_s9000_g19067.t1 |
|---|---|
| Definition | - |
>habu1_s9000_g19067.t1 MLHSVGAQTLQALSQVAACVLLLPRFLLTAVMLWLLDFLCIRKKLLLTAAAAAATLGEEQELAAEDGDSSEGTCPPDDPP LCVSDSNRMFTLESLRAVWHGQKLDFFKAAHVGATAPNPEVVQLDGRTRQRILDYARGKRPLILNFGSCT |
|