Gene
Gene Model ID | habu1_s997_g03488 |
---|---|
Locus | habu1_scaffold997 : 203999 ... 212875 : - |
To GenomeBrowser | habu1_scaffold997:203999..212875 |
Genes list of scaffold | habu1_scaffold997 |
Annotation by Blast2GO
Annotation | GO |
---|---|
neuronal calcium sensor 1 | GO:0005509 GO:0005737 GO:0005886 GO:0030424 GO:0030425 GO:0043231 GO:0070062 |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
habu1_s997_g03488.t1 | 3 | 1 | EF-hand_8 | 24 | 73 | 5.3e-16 | 57.9 | 1.9e-08 | 2.6e-05 | 23.7 |
habu1_s997_g03488.t1 | 2 | 1 | EF-hand_7 | 25 | 72 | 1.2e-23 | 82.9 | 2.3e-08 | 3.1e-05 | 24.0 |
habu1_s997_g03488.t1 | 3 | 1 | EF-hand_1 | 52 | 74 | 7.6e-24 | 81.1 | 1.5e-09 | 2.0e-06 | 26.6 |
habu1_s997_g03488.t1 | 3 | 1 | EF-hand_6 | 52 | 74 | 1.4e-22 | 77.4 | 9.1e-09 | 1.2e-05 | 24.7 |
habu1_s997_g03488.t1 | 3 | 1 | EF-hand_5 | 52 | 71 | 1.1e-17 | 62.5 | 3.5e-08 | 4.7e-05 | 22.5 |
habu1_s997_g03488.t1 | 3 | 2 | EF-hand_8 | 80 | 104 | 5.3e-16 | 57.9 | 3.2e-06 | 0.0043 | 16.6 |
habu1_s997_g03488.t1 | 2 | 2 | EF-hand_7 | 84 | 155 | 1.2e-23 | 82.9 | 8.8e-19 | 1.2e-15 | 57.3 |
habu1_s997_g03488.t1 | 3 | 2 | EF-hand_1 | 85 | 109 | 7.6e-24 | 81.1 | 3.2e-10 | 4.4e-07 | 28.7 |
habu1_s997_g03488.t1 | 3 | 2 | EF-hand_6 | 88 | 109 | 1.4e-22 | 77.4 | 1.2e-08 | 1.6e-05 | 24.3 |
habu1_s997_g03488.t1 | 3 | 2 | EF-hand_5 | 88 | 105 | 1.1e-17 | 62.5 | 1.2e-06 | 0.0016 | 17.7 |
habu1_s997_g03488.t1 | 3 | 3 | EF-hand_8 | 128 | 155 | 5.3e-16 | 57.9 | 1.3e-06 | 0.0017 | 17.9 |
habu1_s997_g03488.t1 | 3 | 3 | EF-hand_1 | 133 | 156 | 7.6e-24 | 81.1 | 1.4e-09 | 1.9e-06 | 26.7 |
habu1_s997_g03488.t1 | 3 | 3 | EF-hand_6 | 133 | 155 | 1.4e-22 | 77.4 | 1.9e-07 | 0.00026 | 20.6 |
habu1_s997_g03488.t1 | 3 | 3 | EF-hand_5 | 136 | 155 | 1.1e-17 | 62.5 | 4.7e-08 | 6.4e-05 | 22.1 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
habu1_s997_g03488.t1 | gi|562876708|ref|XP_006166131.1| | PREDICTED: neuronal calcium sensor 1 [Tupaia chinensis] | 0.0 |
habu1_s997_g03488.t1 | gi|512822357|ref|XP_004879856.1| | 0.0 | |
habu1_s997_g03488.t1 | gi|586526570|ref|XP_006918227.1| | PREDICTED: neuronal calcium sensor 1 [Pteropus alecto] | 0.0 |
habu1_s997_g03488.t1 | gi|733913535|ref|XP_010719197.1| | PREDICTED: neuronal calcium sensor 1 isoform X1 [Meleagris gallopavo] | 0.0 |
habu1_s997_g03488.t1 | gi|541964248|ref|XP_005437263.1| | PREDICTED: neuronal calcium sensor 1 [Falco cherrug] | 0.0 |
Expression profile
Libraries | FPKM |
---|---|
>Adult | |
Venom fang forming tissue | 8.3 |
Venom grand-1 | 3.3 |
Pit, infrared sensing | 6.4 |
Nose | 12.3 |
Brain-1 | 27.4 |
Eye | 4.4 |
fetal fibroblast | 11.6 |
venom gland-2 | 0.7 |
Brain-2 | 37.7 |
Spleen | 0.8 |
Lung | 2.4 |
Liver | 0.3 |
Kidney | 7.0 |
Pancreas | 0.4 |
Small intestine | 1.5 |
Large intestine | 2.0 |
Stomach | 2.5 |
heart | 0.3 |
ovary | 1.7 |
cheek muscle | 0.4 |
Transcript
Transcript ID | habu1_s997_g03488.t1 |
---|---|
Definition | - |
>habu1_s997_g03488.t1 agtcgaggactaaaccggtccggcttgggaatcgattcctttaattcaattcgtgttctcgaaagatccgtatcaaagag ccatttgcaaaatcagcccagattgattcagacgtctggaacaccctgcggtcgctttggagatctgattgacaacaaga ccgggggagggggcagggcagtatgacaccttttgaagtcacagagaaagaagtccagcaatggtataaaggctttatta aggactgcccaagtggacagttggacgcagccggatttcagaaaatctacaagcaatttttcccgtttggtgacccaacc aagtttgcaacgtttgtttttaatgtctttgatgaaaacaaagatggaagaatcgagttttccgaatttatccaggccct ttcagtcacctcccgaggaactctggatgagaaactgcggtgggcctttaaactgtatgacctggataatgatggctaca tcacaagaaatgagatgctggacattgtagatgctatttaccagatggtgggtaacaccgtggagctgccagaagaggag aacaccccggaaaagagggtggaccggatttttgccatgatggacaaaaatgccgatgggaaattaacgttgcaggagtt ccaggagggttcgaaagcggacccttccatcgtccaggccctttccctttatgatggactggtatagtcccacaagccat gctttgacatttggagaagaccttcttccagtgacatcaagctgcccaccccccaacaagaccctcgccggacgttactc tcctgttactcgcgagcaaggggcacgttccaagttcgaccttggcctcaacaacctcctgcttggaatccaccatcggc ccccatcggctgctttgattatcatccttttaaaagagagacagacggaggaggacgggcgaggggtgggagtcctacat cggatggaggcggttcacgcacatttccctgtctcccccccccttgtgttttgtttggaatgaacttgagacttcatatt tcttccctggggggcggtggcagcgggattgaagagaccgagaggccactgttagatcggatgggaaannnnnnnnnnnn nnn |
Protein
Protein ID | habu1_s997_g03488.t1 |
---|---|
Definition | - |
>habu1_s997_g03488.t1 MTPFEVTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGT LDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKAD PSIVQALSLYDGLV |