Gene
| Gene Model ID | pfu_aug1.0_104153.1_64246 |
|---|---|
| Locus | scaffold104153.1 : 1 ... 1222 : - |
| To GenomeBrowser | scaffold104153.1:1..1222 |
| Genes list of scaffold | scaffold104153.1 |
| Synonym | pfu_aug2.0_116.1_20262 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_104153.1_64246.t1 | 1 | 1 | Romo1 | 18 | 84 | 2.8e-27 | 94.6 | 4.4e-31 | 3.3e-27 | 94.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_104153.1_64246.t1 | gi|157118755|ref|XP_001653245.1| | AAEL008394-PA [Aedes aegypti] | 1.0e-27 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 2 |
| egg-4cell | 2 |
| 8-16cell | 2 |
| egg-Dshape | 2 |
| trochophore | 2 |
| >Adult tissues | |
| Dshape | 1 |
| maleGonad | 1 |
| mantle | 1 |
Transcript
| Transcript ID | pfu_aug1.0_104153.1_64246.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_104153.1_64246.t1 atgccagctcctccaccctctgggtacggtcagtacggacagccgtcacaaccgtcatgttttgacaaaatgaaagtagg atttatgatgggtttatgtgtgggtatggcatcaggaggactgtttggaggatttagtgcactaaggtatggattacgag gacgggaattactacagaccgttggaaaatcaatgttacaaggaggtgggacgtttgggacattcctagcgatcggtacc ggaataaggtgttaa |
|
Protein
| Protein ID | pfu_aug1.0_104153.1_64246.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_104153.1_64246.t1 MPAPPPSGYGQYGQPSQPSCFDKMKVGFMMGLCVGMASGGLFGGFSALRYGLRGRELLQTVGKSMLQGGGTFGTFLAIGT GIRC |
|