Gene
| Gene Model ID | pfu_aug1.0_11844.1_10377 |
|---|---|
| Locus | scaffold11844.1 : 12630 ... 16625 : - |
| To GenomeBrowser | scaffold11844.1:12630..16625 |
| Genes list of scaffold | scaffold11844.1 |
| Synonym | pfu_aug2.0_64.1_13524 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_11844.1_10377.t1 | 1 | 1 | TspO_MBR | 2 | 78 | 9.1e-29 | 99.8 | 6.7e-33 | 9.9e-29 | 99.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_11844.1_10377.t1 | gi|147906451|ref|NP_001080225.1| | translocator protein (18kDa) [Xenopus laevis] | 1.0e-22 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 4 |
| egg-4cell | 1 |
| 8-16cell | 1 |
| egg-Dshape | 3 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| adductorMuscle | 2 |
| maleGonad | 2 |
Transcript
| Transcript ID | pfu_aug1.0_11844.1_10377.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_11844.1_10377.t1 atgccactggcactatacggcacacagctggcacttaactgggcgtggtcacccatcttctttggtgctcataaacttgg attggccaccatagagattgtagggttgtggggttccattgtggccaccactgtcgcattccacccgatcaatgctacgg cttcctaccttatgatgccctacctagcctgggtgacctttgccacggccttgaccttcaggatttggcagttaaacaag gacaaaaaggactaa |
|
Protein
| Protein ID | pfu_aug1.0_11844.1_10377.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_11844.1_10377.t1 MPLALYGTQLALNWAWSPIFFGAHKLGLATIEIVGLWGSIVATTVAFHPINATASYLMMPYLAWVTFATALTFRIWQLNK DKKD |
|