Gene
| Gene Model ID | pfu_aug1.0_1201.1_07833 |
|---|---|
| Locus | scaffold1201.1 : 7786 ... 29065 : - |
| To GenomeBrowser | scaffold1201.1:7786..29065 |
| Genes list of scaffold | scaffold1201.1 |
| Synonym | pfu_aug2.0_621.1_04408 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_1201.1_07833.t1 | 1 | 1 | LSM | 8 | 70 | 4.1e-19 | 67.9 | 3.1e-23 | 4.5e-19 | 67.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_1201.1_07833.t1 | gi|332018098|gb|EGI58712.1| | 3.0e-29 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-4cell | 1 |
| 8-16cell | 1 |
| egg-Dshape | 1 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| adductorMuscle | 1 |
| maleGonad | 1 |
| mantle | 1 |
| mantleEdge | 1 |
| mantlePallium | 1 |
| pearlSac | 1 |
Transcript
| Transcript ID | pfu_aug1.0_1201.1_07833.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_1201.1_07833.t1 atgagcaaagcacacccaccagaattgaaaaagtacatggagaagagaataaacttaaagctaaatggcggcagacaaat acagggaatccttcgaggatttgacccgttcatgaatctcgtagttgatgaaagcatagaggaaacaaagcttggtgaaa agaacacaatcggaatggtggtggtacgaggaaacagcataattctgttagaagctttagatcgcatcggataa |
|
Protein
| Protein ID | pfu_aug1.0_1201.1_07833.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_1201.1_07833.t1 MSKAHPPELKKYMEKRINLKLNGGRQIQGILRGFDPFMNLVVDESIEETKLGEKNTIGMVVVRGNSIILLEALDRIG |
|