Gene
| Gene Model ID | pfu_aug1.0_15458.1_46880 |
|---|---|
| Locus | scaffold15458.1 : 33476 ... 38486 : + |
| To GenomeBrowser | scaffold15458.1:33476..38486 |
| Genes list of scaffold | scaffold15458.1 |
| Synonym | pfu_aug2.0_90.1_00203 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_15458.1_46880.t1 | 1 | 1 | Ribosomal_S7e | 7 | 49 | 2.5e-11 | 43.4 | 1.8e-15 | 2.7e-11 | 43.3 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_15458.1_46880.t1 | gi|22758886|gb|AAN05602.1| | ribosomal protein S7 [Argopecten irradians] | 4.0e-18 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 2 |
| egg-4cell | 1 |
| 8-16cell | 1 |
| egg-Dshape | 1 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| maleGonad | 1 |
| mantle | 1 |
| mantleEdge | 1 |
| mantlePallium | 1 |
| pearlSac | 1 |
Transcript
| Transcript ID | pfu_aug1.0_15458.1_46880.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_15458.1_46880.t1 atgtattcggcgagcgctaaaattgttaagccccaaggggaaaagccagatgagtttgaatcttcaatctcacaggcatt gctggagttggaaatgaatagtgatctaaaagctcagctcagagaactgtatatcactggtgccaag |
|
Protein
| Protein ID | pfu_aug1.0_15458.1_46880.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_15458.1_46880.t1 MYSASAKIVKPQGEKPDEFESSISQALLELEMNSDLKAQLRELYITGAK |
|