Gene
Gene Model ID | pfu_aug1.0_15482.1_61501 |
---|---|
Locus | scaffold15482.1 : 9726 ... 20028 : + |
To GenomeBrowser | scaffold15482.1:9726..20028 |
Genes list of scaffold | scaffold15482.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-Mad |
Description | Best hit to NP_569157 max-interacting protein 1 isoform b [Homo sapiens] with 6e-16 by a BLASTP search against NCBI Homo sapiens nr database. We could not retrieve full bHLH domain and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Transcript
Transcript ID | pfu_aug1.0_15482.1_61501.t1 |
---|---|
Definition | - |
>pfu_aug1.0_15482.1_61501.t1 atgcaatcgaacaccgtgccgaactgcaggttccgtattgaacaaaccaaattgtacgtcagacggagagctcatcttag gtactgtttagaaaaattaaaagatattgtaccagttggaggagactcaactcgacacaccactcttggacttttaacaa aagccaaatcatttattaggaaggagggcactccttttatgcccgggatatggataaatgtgctcctcctcgactggtaa |
Protein
Protein ID | pfu_aug1.0_15482.1_61501.t1 |
---|---|
Definition | - |
>pfu_aug1.0_15482.1_61501.t1 MQSNTVPNCRFRIEQTKLYVRRRAHLRYCLEKLKDIVPVGGDSTRHTTLGLLTKAKSFIRKEGTPFMPGIWINVLLLDW |