Gene
| Gene Model ID | pfu_aug1.0_15766.1_61549 |
|---|---|
| Locus | scaffold15766.1 : 6658 ... 12588 : - |
| To GenomeBrowser | scaffold15766.1:6658..12588 |
| Genes list of scaffold | scaffold15766.1 |
| Synonym | NA |
Manual annotation
| Study field | Transcription Factors |
|---|---|
| Gene name | Pfu-MITF-related3 |
| Description | Best hit to CAI22454 transcription factor EB [Homo sapiens] by a BLASTP search against NCBI Homo sapiens nr database. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
| mRNA evidence |
Transcript
| Transcript ID | pfu_aug1.0_15766.1_61549.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_15766.1_61549.t1 ttaccacactctaacctcatgaattcagtatttgaggtgaaatctccagaaagccagtcacctgtaaatacatcatcgtc ttgtccagccaaatttgctgtgaaagtaccagactttttaacggacgaagaagcgaggctttggcagaaagacagacaaa agaaagataaccacaacatgatcattcgcaaagcataa |
|
Protein
| Protein ID | pfu_aug1.0_15766.1_61549.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_15766.1_61549.t1 LPHSNLMNSVFEVKSPESQSPVNTSSSCPAKFAVKVPDFLTDEEARLWQKDRQKKDNHNMIIRKA |
|