Gene
Gene Model ID | pfu_aug1.0_15766.1_61549 |
---|---|
Locus | scaffold15766.1 : 6658 ... 12588 : - |
To GenomeBrowser | scaffold15766.1:6658..12588 |
Genes list of scaffold | scaffold15766.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-MITF-related3 |
Description | Best hit to CAI22454 transcription factor EB [Homo sapiens] by a BLASTP search against NCBI Homo sapiens nr database. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Transcript
Transcript ID | pfu_aug1.0_15766.1_61549.t1 |
---|---|
Definition | - |
>pfu_aug1.0_15766.1_61549.t1 ttaccacactctaacctcatgaattcagtatttgaggtgaaatctccagaaagccagtcacctgtaaatacatcatcgtc ttgtccagccaaatttgctgtgaaagtaccagactttttaacggacgaagaagcgaggctttggcagaaagacagacaaa agaaagataaccacaacatgatcattcgcaaagcataa |
Protein
Protein ID | pfu_aug1.0_15766.1_61549.t1 |
---|---|
Definition | - |
>pfu_aug1.0_15766.1_61549.t1 LPHSNLMNSVFEVKSPESQSPVNTSSSCPAKFAVKVPDFLTDEEARLWQKDRQKKDNHNMIIRKA |