Gene
| Gene Model ID | pfu_aug1.0_159902.1_35621 |
|---|---|
| Locus | scaffold159902.1 : 1 ... 904 : - |
| To GenomeBrowser | scaffold159902.1:1..904 |
| Genes list of scaffold | scaffold159902.1 |
| Synonym | pfu_aug2.0_220.1_00449 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_159902.1_35621.t1 | 1 | 1 | Maf1 | 1 | 35 | 9.6e-16 | 58.1 | 6.9e-20 | 1.0e-15 | 58.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_159902.1_35621.t1 | gi|260810167|ref|XP_002599875.1| | hypothetical protein BRAFLDRAFT_230187 [Branchiostoma floridae] | 2.0e-14 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| 8-16cell | 1 |
| egg-Dshape | 1 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| adductorMuscle | 1 |
| maleGonad | 1 |
| mantle | 1 |
Transcript
| Transcript ID | pfu_aug1.0_159902.1_35621.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_159902.1_35621.t1 ttataatccagacctggcttcagatccgtacggtgaagagggctgtatttggtccttcaactacttcttctacaatcgca aactgaaacgcatcgttttctttacatgtaaagcttccaggtaa |
|
Protein
| Protein ID | pfu_aug1.0_159902.1_35621.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_159902.1_35621.t1 YNPDLASDPYGEEGCIWSFNYFFYNRKLKRIVFFTCKASR |
|