Gene
| Gene Model ID | pfu_aug1.0_19060.1_54541 |
|---|---|
| Locus | scaffold19060.1 : 5935 ... 10627 : - |
| To GenomeBrowser | scaffold19060.1:5935..10627 |
| Genes list of scaffold | scaffold19060.1 |
| Synonym | NA |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_19060.1_54541.t1 | 1 | 1 | HGTP_anticodon | 12 | 104 | 3.4e-20 | 71.7 | 5.3e-24 | 4.0e-20 | 71.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_19060.1_54541.t1 | gi|340723169|ref|XP_003399968.1| | PREDICTED: LOW QUALITY PROTEIN: glycine--tRNA ligase [Bombus terrestris] | 0.0 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-4cell | 1 |
| egg-Dshape | 1 |
| trochophore | 3 |
| >Adult tissues | |
| adductorMuscle | 1 |
| maleGonad | 1 |
| mantle | 1 |
| mantlePallium | 2 |
| pearlSac | 3 |
Transcript
| Transcript ID | pfu_aug1.0_19060.1_54541.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_19060.1_54541.t1 tacctttctttaccacctgtgatagcaccgtataaatgttcagtattacccttgagtagtaaaccagactttagagatct tgtctcagatttatcacgtaacttgacgagatgtgacatatctcataaagttgatgacagtggcggatccattggcagac gatatgctcgaacggatgccatatcaatacctttcggtgttaccatagactttgacagtctgaaggcacctcatacggca acactgagagaaagggacacaactaaacaaattcgtgcggagataaaagagatccctgagattgtacgagatctagcaac cggacgaagaacatgggacgatgtattgaataactaccctctgtttgaacagcaagaagctacaaagtga |
|
Protein
| Protein ID | pfu_aug1.0_19060.1_54541.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_19060.1_54541.t1 YLSLPPVIAPYKCSVLPLSSKPDFRDLVSDLSRNLTRCDISHKVDDSGGSIGRRYARTDAISIPFGVTIDFDSLKAPHTA TLRERDTTKQIRAEIKEIPEIVRDLATGRRTWDDVLNNYPLFEQQEATK |
|