Gene
Gene Model ID | pfu_aug1.0_19193.1_54552 |
---|---|
Locus | scaffold19193.1 : 1 ... 5755 : - |
To GenomeBrowser | scaffold19193.1:1..5755 |
Genes list of scaffold | scaffold19193.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-USF |
Description | Best hit to AAB24368 upstream stimulatory factor [Homo sapiens] with 2e-26 by a BLASTP search against NCBI Homo sapiens nr database. We could not retrieve full bHLH domain and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug1.0_19193.1_54552.t1 | gi|1022700|gb|AAA79690.1| | USF [Lytechinus variegatus] | 9.0e-20 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)Libraries | EST count |
---|---|
>Embryonic/Larval stages | |
mix | 2 |
>Adult tissues |
Transcript
Transcript ID | pfu_aug1.0_19193.1_54552.t1 |
---|---|
Definition | - |
>pfu_aug1.0_19193.1_54552.t1 atgagtaaaggtggtatcctatcaaaagcctgtgattatatccaagagttgagagcagcaaacaacagaatggcagaatc gttaaaagaaacagagagactttctgtagatttggacattgtaagacaacaatgtgaagaactcaagaatgagaacgcta tattacgtgcacagctacaatcacacggacttatacccgatattccaggtggaggctcgtaa |
Protein
Protein ID | pfu_aug1.0_19193.1_54552.t1 |
---|---|
Definition | - |
>pfu_aug1.0_19193.1_54552.t1 MSKGGILSKACDYIQELRAANNRMAESLKETERLSVDLDIVRQQCEELKNENAILRAQLQSHGLIPDIPGGGS |