Gene
| Gene Model ID | pfu_aug1.0_19193.1_54552 |
|---|---|
| Locus | scaffold19193.1 : 1 ... 5755 : - |
| To GenomeBrowser | scaffold19193.1:1..5755 |
| Genes list of scaffold | scaffold19193.1 |
| Synonym | NA |
Manual annotation
| Study field | Transcription Factors |
|---|---|
| Gene name | Pfu-USF |
| Description | Best hit to AAB24368 upstream stimulatory factor [Homo sapiens] with 2e-26 by a BLASTP search against NCBI Homo sapiens nr database. We could not retrieve full bHLH domain and therefore this gene is not included in the bHLH annotation paper. |
| mRNA evidence |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_19193.1_54552.t1 | gi|1022700|gb|AAA79690.1| | USF [Lytechinus variegatus] | 9.0e-20 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 2 |
| >Adult tissues | |
Transcript
| Transcript ID | pfu_aug1.0_19193.1_54552.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_19193.1_54552.t1 atgagtaaaggtggtatcctatcaaaagcctgtgattatatccaagagttgagagcagcaaacaacagaatggcagaatc gttaaaagaaacagagagactttctgtagatttggacattgtaagacaacaatgtgaagaactcaagaatgagaacgcta tattacgtgcacagctacaatcacacggacttatacccgatattccaggtggaggctcgtaa |
|
Protein
| Protein ID | pfu_aug1.0_19193.1_54552.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_19193.1_54552.t1 MSKGGILSKACDYIQELRAANNRMAESLKETERLSVDLDIVRQQCEELKNENAILRAQLQSHGLIPDIPGGGS |
|