Gene
| Gene Model ID | pfu_aug1.0_25206.1_11676 |
|---|---|
| Locus | scaffold25206.1 : 14138 ... 23095 : - |
| To GenomeBrowser | scaffold25206.1:14138..23095 |
| Genes list of scaffold | scaffold25206.1 |
| Synonym | pfu_aug2.0_224.1_13818 |
Manual annotation
| Study field | Transcription Factors |
|---|---|
| Gene name | Pfu-Hairy_orange domain containing 3 |
| Description | Best hit to NP_001161564 hey-like transcription factor [Saccoglossus kowalevskii] with 3e-14 by a BLASTP search against NCBI nr. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
| mRNA evidence |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_25206.1_11676.t1 | 2 | 1 | Hairy_orange | 78 | 117 | 2.5e-08 | 33.5 | 7.5e-12 | 5.5e-08 | 32.4 |
| pfu_aug1.0_25206.1_11676.t1 | 2 | 2 | Hairy_orange | 130 | 137 | 2.5e-08 | 33.5 | 0.76 | 5600.0 | -2.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_25206.1_11676.t1 | gi|269785273|ref|NP_001161564.1| | hey-like transcription factor [Saccoglossus kowalevskii] | 2.0e-12 |
Transcript
| Transcript ID | pfu_aug1.0_25206.1_11676.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_25206.1_11676.t1 atgcatagttactaccattacgacctggggtttatgatttttttcttaaaaggagagtggatcgcatatttacattttgc atacgtgataacgtcaatcgactgtttacaatctgaaactactcctttgtatgtatatgaagcaagaaagaaatcttttg agacaatatacacaactatttctgtaggagactggtttagcacagacatatggacggacttcatgcatcactataaggtc ggctacaacgactgcatccgggaaatccagaggttcatgactgacgtggagggtgtcaacgcagatgacgatagatgcat ccggttaatttcctatttgcagacgagattcagaccagattcttctatcagtggtggcgctgcttaccgcgaggcgctag aacgtctgagcagtcacatactaacaacttaa |
|
Protein
| Protein ID | pfu_aug1.0_25206.1_11676.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_25206.1_11676.t1 MHSYYHYDLGFMIFFLKGEWIAYLHFAYVITSIDCLQSETTPLYVYEARKKSFETIYTTISVGDWFSTDIWTDFMHHYKV GYNDCIREIQRFMTDVEGVNADDDRCIRLISYLQTRFRPDSSISGGAAYREALERLSSHILTT |
|