Gene
| Gene Model ID | pfu_aug1.0_27375.1_04572 |
|---|---|
| Locus | scaffold27375.1 : 1 ... 11522 : + |
| To GenomeBrowser | scaffold27375.1:1..11522 |
| Genes list of scaffold | scaffold27375.1 |
| Synonym | pfu_aug2.0_357.1_23919 |
Manual annotation
| Study field | Reproduction |
|---|---|
| Gene name | C1q domain containing protein |
| Description | Best hit to MgC1q10. 112 bits, 4e-23 |
| mRNA evidence |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_27375.1_04572.t1 | 1 | 1 | C1q | 18 | 110 | 1.1e-19 | 70.7 | 8.8e-24 | 1.3e-19 | 70.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_27375.1_04572.t1 | gi|325504319|emb|CBX41659.1| | putative C1q domain containing protein MgC1q10 [Mytilus galloprovincialis] | 3.0e-23 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-Dshape | 1 |
| >Adult tissues | |
Transcript
| Transcript ID | pfu_aug1.0_27375.1_04572.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_27375.1_04572.t1 gaattcccaatttcttccctgcagtacgagtagcacatacagataaatatgtagcattttctgtcggtctaacgcacaac ctgaactattcatctgccgtcaacataacgtacgacaaggttttcctcaacctaggagatggttacgatataaatacagg aattttcacgtgccctcacgcgggaacgtacgcttttctgattcatggattatcccagagtgtctcacagttgaaccttg acttgtaccggaacaacgattacattgtgagtgcctatgcacatgctcgaaatgattacgcttccgcccatcaagctgtt gtactgaaactatatgaatgtaagtga |
|
Protein
| Protein ID | pfu_aug1.0_27375.1_04572.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_27375.1_04572.t1 IPNFFPAVRVAHTDKYVAFSVGLTHNLNYSSAVNITYDKVFLNLGDGYDINTGIFTCPHAGTYAFLIHGLSQSVSQLNLD LYRNNDYIVSAYAHARNDYASAHQAVVLKLYECK |
|