Gene
| Gene Model ID | pfu_aug1.0_301.1_14966 |
|---|---|
| Locus | scaffold301.1 : 162848 ... 167525 : - |
| To GenomeBrowser | scaffold301.1:162848..167525 |
| Genes list of scaffold | scaffold301.1 |
| Synonym | pfu_aug2.0_228.1_27077 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_301.1_14966.t1 | 1 | 1 | PHF5 | 1 | 104 | 0.0 | 164.5 | 0.0 | 0.0 | 164.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_301.1_14966.t1 | gi|260801040|ref|XP_002595404.1| | hypothetical protein BRAFLDRAFT_57503 [Branchiostoma floridae] | 0.0 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-4cell | 1 |
| egg-Dshape | 1 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| maleGonad | 1 |
| mantle | 1 |
| pearlSac | 1 |
Transcript
| Transcript ID | pfu_aug1.0_301.1_14966.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_301.1_14966.t1 atggcaaagcatcatcccgatctaatcttttgtagaaaacaacctggagtcgctattggaagattatgtgaaaaatgtga tggtaaatgtgtgatatgtgattcctatgtgcgtccgtgtacgttagtgaggatatgtgacgagtgtaactatggttcat atcagggaaggtgtgtcatctgtggtgggccgggagtatcagatgcctattactgtaaagagtgcactatcatggagaaa gatagagacggatgcccaaaaattgtaaaccttggaagtgctaaaacagacttattctatgaaaggaagaaatatgggtt caagaagaggtga |
|
Protein
| Protein ID | pfu_aug1.0_301.1_14966.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_301.1_14966.t1 MAKHHPDLIFCRKQPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIMEK DRDGCPKIVNLGSAKTDLFYERKKYGFKKR |
|