Gene
Gene Model ID | pfu_aug1.0_30743.1_26538 |
---|---|
Locus | scaffold30743.1 : 1 ... 785 : - |
To GenomeBrowser | scaffold30743.1:1..785 |
Genes list of scaffold | scaffold30743.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-HES-like1 |
Description | The predicted protein showed weak similarity with Homo sapiens and Drosophila melanogaster HES proteins. We could not retrieve full bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug1.0_30743.1_26538.t1 | 2 | 1 | HLH | 8 | 16 | 9.5e-08 | 31.6 | 0.66 | 3200.0 | -2.2 |
pfu_aug1.0_30743.1_26538.t1 | 2 | 2 | HLH | 33 | 66 | 9.5e-08 | 31.6 | 1.9e-11 | 9.5e-08 | 31.6 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)Libraries | EST count |
---|---|
>Embryonic/Larval stages | |
mix | 2 |
>Adult tissues |
Transcript
Transcript ID | pfu_aug1.0_30743.1_26538.t1 |
---|---|
Definition | - |
>pfu_aug1.0_30743.1_26538.t1 atgatggagacttctgacgaagaaaatgagaagatgaaaaagatagaaatgacagggaaagaatcgaaggggaccgacaa aggaacggtgacaaagaaaaggataaataaacctatgatagagagaagacgacgggaaagaataaacgaatgtctacagc agttatattctctaataacggaactggacaaggagaaaccaaag |
Protein
Protein ID | pfu_aug1.0_30743.1_26538.t1 |
---|---|
Definition | - |
>pfu_aug1.0_30743.1_26538.t1 MMETSDEENEKMKKIEMTGKESKGTDKGTVTKKRINKPMIERRRRERINECLQQLYSLITELDKEKPK |