Gene
| Gene Model ID | pfu_aug1.0_30743.1_26538 |
|---|---|
| Locus | scaffold30743.1 : 1 ... 785 : - |
| To GenomeBrowser | scaffold30743.1:1..785 |
| Genes list of scaffold | scaffold30743.1 |
| Synonym | NA |
Manual annotation
| Study field | Transcription Factors |
|---|---|
| Gene name | Pfu-HES-like1 |
| Description | The predicted protein showed weak similarity with Homo sapiens and Drosophila melanogaster HES proteins. We could not retrieve full bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
| mRNA evidence |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_30743.1_26538.t1 | 2 | 1 | HLH | 8 | 16 | 9.5e-08 | 31.6 | 0.66 | 3200.0 | -2.2 |
| pfu_aug1.0_30743.1_26538.t1 | 2 | 2 | HLH | 33 | 66 | 9.5e-08 | 31.6 | 1.9e-11 | 9.5e-08 | 31.6 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 2 |
| >Adult tissues | |
Transcript
| Transcript ID | pfu_aug1.0_30743.1_26538.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_30743.1_26538.t1 atgatggagacttctgacgaagaaaatgagaagatgaaaaagatagaaatgacagggaaagaatcgaaggggaccgacaa aggaacggtgacaaagaaaaggataaataaacctatgatagagagaagacgacgggaaagaataaacgaatgtctacagc agttatattctctaataacggaactggacaaggagaaaccaaag |
|
Protein
| Protein ID | pfu_aug1.0_30743.1_26538.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_30743.1_26538.t1 MMETSDEENEKMKKIEMTGKESKGTDKGTVTKKRINKPMIERRRRERINECLQQLYSLITELDKEKPK |
|