Gene
| Gene Model ID | pfu_aug1.0_337281.1_07113 |
|---|---|
| Locus | scaffold337281.1 : 1 ... 480 : + |
| To GenomeBrowser | scaffold337281.1:1..480 |
| Genes list of scaffold | scaffold337281.1 |
| Synonym | NA |
Manual annotation
| Study field | ribosomal |
|---|---|
| Gene name | 60S ribosomal protein L23 |
| Description | High homology to known gene |
| mRNA evidence |
| Study field | Biomineralization |
|---|---|
| Gene name | ferritin-like protein |
| Description | high homology to nr |
| mRNA evidence |
| Study field | Biomineralization |
|---|---|
| Gene name | ferritin-like protein |
| Description | high homology to nr |
| mRNA evidence |
| Study field | Biomineralization |
|---|---|
| Gene name | ferritin_like protein |
| Description | high homology to nr |
| mRNA evidence |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_337281.1_07113.t1 | 1 | 1 | Ribosomal_L14 | 10 | 66 | 8.1e-12 | 44.9 | 6.3e-16 | 9.3e-12 | 44.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_337281.1_07113.t1 | gi|22758906|gb|AAN05612.1| | ribosomal protein L17A [Argopecten irradians] | 7.0e-28 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 2 |
| egg-4cell | 1 |
| 8-16cell | 1 |
| egg-Dshape | 1 |
| trochophore | 2 |
| >Adult tissues | |
| Dshape | 2 |
| adductorMuscle | 1 |
| maleGonad | 1 |
| mantle | 1 |
| mantleEdge | 1 |
| mantlePallium | 1 |
| pearlSac | 1 |
Transcript
| Transcript ID | pfu_aug1.0_337281.1_07113.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_337281.1_07113.t1 gggagggaagttccgtatatccctggctttgccagtaggcgctgttatcaactgtgctgataatactggtgccaagaact tatacgtcattgctgtctacggcattaagggacgccttaacagactaccggcagccggggccggtgacatgattgttgcc acagtcaaaaagggaaaacctgagttaaggaaaaaggtacatctctttcttcaggact |
|
Protein
| Protein ID | pfu_aug1.0_337281.1_07113.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_337281.1_07113.t1 GGKFRISLALPVGAVINCADNTGAKNLYVIAVYGIKGRLNRLPAAGAGDMIVATVKKGKPELRKKVHLFLQD |
|