Gene
| Gene Model ID | pfu_aug1.0_3553.1_30443 |
|---|---|
| Locus | scaffold3553.1 : 39426 ... 43065 : + |
| To GenomeBrowser | scaffold3553.1:39426..43065 |
| Genes list of scaffold | scaffold3553.1 |
| Synonym | NA |
Manual annotation
| Study field | mitochondrial |
|---|---|
| Gene name | cytochrome b |
| Description | 99% identity with Pinctada fucata mitochondrial CYTB mRNA for cytochrome b, complete cds (GenBank: AB684317.1) |
| mRNA evidence |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_3553.1_30443.t1 | 1 | 1 | Cytochrom_B_N_2 | 19 | 71 | 5.2e-14 | 52.3 | 8.0e-18 | 5.9e-14 | 52.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_3553.1_30443.t1 | gi|170787164|gb|ACB38226.1| | cytochrome b, partial (mitochondrion) [Tyto longimembris] | 2.0e-22 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-4cell | 2 |
| 8-16cell | 2 |
| egg-Dshape | 3 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| adductorMuscle | 1 |
| maleGonad | 1 |
| mantle | 3 |
Transcript
| Transcript ID | pfu_aug1.0_3553.1_30443.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_3553.1_30443.t1 atgcgggacgttcagggggggtggttcgtgcgcaactgtcatgttagaggggctaactttatatttatttgcgtctactt gcatattggtcgggggctgtattatgggtcgtatttgataaagagcgtctggtttagagggatagcaatccttattctcc taatggccatcgccttcttaggttatgtgttgccttggggcaggatgtcctactga |
|
Protein
| Protein ID | pfu_aug1.0_3553.1_30443.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_3553.1_30443.t1 MRDVQGGWFVRNCHVRGANFIFICVYLHIGRGLYYGSYLIKSVWFRGIAILILLMAIAFLGYVLPWGRMSY |
|