Gene
| Gene Model ID | pfu_aug1.0_3553.1_30446 |
|---|---|
| Locus | scaffold3553.1 : 62586 ... 67678 : + |
| To GenomeBrowser | scaffold3553.1:62586..67678 |
| Genes list of scaffold | scaffold3553.1 |
| Synonym | NA |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_3553.1_30446.t1 | 1 | 1 | COX3 | 21 | 67 | 8.3e-06 | 25.4 | 6.0e-10 | 8.9e-06 | 25.3 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 3 |
| egg-4cell | 1 |
| 8-16cell | 2 |
| egg-Dshape | 2 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| adductorMuscle | 2 |
| maleGonad | 1 |
| mantle | 1 |
Transcript
| Transcript ID | pfu_aug1.0_3553.1_30446.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_3553.1_30446.t1 atgcgcggtaaagagagggggggagtaaagcggcccgttacgcgggtaatcccgcgtaccccattccacctgcctgatcc tagcccgtggccattttgggctgcgctgtcattggagggggttcttttggggatggctaagtatttccatggaatagacg caagggttttttttgttaggggagtatttcttgtatatgtcgtacacatgtga |
|
Protein
| Protein ID | pfu_aug1.0_3553.1_30446.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_3553.1_30446.t1 MRGKERGGVKRPVTRVIPRTPFHLPDPSPWPFWAALSLEGVLLGMAKYFHGIDARVFFVRGVFLVYVVHM |
|