Gene
Gene Model ID | pfu_aug1.0_3633.1_52045 |
---|---|
Locus | scaffold3633.1 : 1 ... 33738 : + |
To GenomeBrowser | scaffold3633.1:1..33738 |
Genes list of scaffold | scaffold3633.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-AHR |
Description | Best hit to EAW50997 hCG1985585, isoform CRA_c [Homo sapiens] with 1e-25 by a BLASTP search against NCBI Homo sapiens nr database. This annotation is based on NJ, ML, and BI. |
mRNA evidence |
Study field | Transcription Factors |
---|---|
Gene name | Pfu-orphan-HLH-e |
Description | scaffold 2589.1; 3681...3857 (-) was used for analyses. Best hit to EAW50997 hCG1985585, isoform CRA_c by a BLASTP search against NCBI Homo sapiens nr database. This annotation is based on NJ, ML, and BI. |
mRNA evidence |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug1.0_3633.1_52045.t1 | 1 | 1 | HLH | 15 | 56 | 1.0e-08 | 34.7 | 8.7e-13 | 1.3e-08 | 34.4 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug1.0_3633.1_52045.t1 | gi|7839662|gb|AAF70378.1|AF261769_1 | aryl hydrocarbon receptor-like protein [Mya arenaria] | 5.0e-26 |
Transcript
Transcript ID | pfu_aug1.0_3633.1_52045.t1 |
---|---|
Definition | - |
>pfu_aug1.0_3633.1_52045.t1 ggtcaagaccccgacgaaagaccccccgaaaagtaatcccagtaaacgtcacagagaacgcctgaactcagagttagacc atctcgcaagtttgttgccgtttgaacagagcgttatttccaaactagacaaactctccattctgagactggccgtgagc tatctgaggacaaaaagctactttgcagataattag |
Protein
Protein ID | pfu_aug1.0_3633.1_52045.t1 |
---|---|
Definition | - |
>pfu_aug1.0_3633.1_52045.t1 VKTPTKDPPKSNPSKRHRERLNSELDHLASLLPFEQSVISKLDKLSILRLAVSYLRTKSYFADN |