Gene
| Gene Model ID | pfu_aug1.0_491.1_43708 |
|---|---|
| Locus | scaffold491.1 : 41506 ... 55325 : + |
| To GenomeBrowser | scaffold491.1:41506..55325 |
| Genes list of scaffold | scaffold491.1 |
| Synonym | pfu_aug2.0_217.1_23693 |
Manual annotation
| Study field | Biomineralization |
|---|---|
| Gene name | sod |
| Description | reciprocal TBLASTN best hit to NCBI Accession FM177867.1 Mytilus galloprovincialis mRNA for superoxide dismutase (sod gene) |
| mRNA evidence |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_491.1_43708.t1 | 1 | 1 | Sod_Cu | 5 | 148 | 0.0 | 168.2 | 0.0 | 0.0 | 168.1 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_491.1_43708.t1 | gi|215263232|emb|CAQ68509.1| | superoxide dismutase [Mytilus galloprovincialis] | 0.0 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-4cell | 1 |
| 8-16cell | 1 |
| egg-Dshape | 1 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| adductorMuscle | 1 |
| maleGonad | 1 |
| mantle | 1 |
| mantleEdge | 1 |
| mantlePallium | 1 |
| pearlSac | 1 |
Transcript
| Transcript ID | pfu_aug1.0_491.1_43708.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_491.1_43708.t1 atgtcagttaaagctgtttgtgttttaaaaggagacggtgctgtgacgggaacaattcatttggcacaggaggatggaca ttgtaaagtaactggagaaatcacaggtctagctcctggtcaacatggattccacgtacatcagtttggggacaacacaa atggttgcactagtgctggtccacacttcaatccccatggtaaaacgcatggtgctccaagtgatgaaattaggcatgta ggtgacttgggaaatgtcacagcagatgctagcggcaaggctgttataaacataacagatagtcaagtaacccttactgg acctaattcagtgataggaagaacagtggtggtgcatgcggacattgatgatcttggtaaaggaggtcatgagttgagtt tgactacagggaatgccggagggcgattggcatgcggtgtgatcggtatcaccaagtaa |
|
Protein
| Protein ID | pfu_aug1.0_491.1_43708.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_491.1_43708.t1 MSVKAVCVLKGDGAVTGTIHLAQEDGHCKVTGEITGLAPGQHGFHVHQFGDNTNGCTSAGPHFNPHGKTHGAPSDEIRHV GDLGNVTADASGKAVINITDSQVTLTGPNSVIGRTVVVHADIDDLGKGGHELSLTTGNAGGRLACGVIGITK |
|