Gene
Gene Model ID | pfu_aug1.0_505084.1_65113 |
---|---|
Locus | scaffold505084.1 : 1 ... 298 : + |
To GenomeBrowser | scaffold505084.1:1..298 |
Genes list of scaffold | scaffold505084.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-SREBP-related3 |
Description | Best hit to AAH26962 Unknown (protein for IMAGE:5103173), partial [Homo sapiens] by a BLASTP search against NCBI nr database. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Transcript
Transcript ID | pfu_aug1.0_505084.1_65113.t1 |
---|---|
Definition | - |
>pfu_aug1.0_505084.1_65113.t1 agagttcagacagtgaggtacctgatagggaacaagccaaggccttattgatggcgggtcgtcatctcccacctgctata ttaccatccaacgaggatcgtgtcacccttatatctgaggcaagcaagatgtatgaagtccttggtgataaaaaatcagt acagagctgccgtcgcgttctcatgcagtttgaaaacaat |
Protein
Protein ID | pfu_aug1.0_505084.1_65113.t1 |
---|---|
Definition | - |
>pfu_aug1.0_505084.1_65113.t1 SSDSEVPDREQAKALLMAGRHLPPAILPSNEDRVTLISEASKMYEVLGDKKSVQSCRRVLMQFENN |