Gene
| Gene Model ID | pfu_aug1.0_505084.1_65113 |
|---|---|
| Locus | scaffold505084.1 : 1 ... 298 : + |
| To GenomeBrowser | scaffold505084.1:1..298 |
| Genes list of scaffold | scaffold505084.1 |
| Synonym | NA |
Manual annotation
| Study field | Transcription Factors |
|---|---|
| Gene name | Pfu-SREBP-related3 |
| Description | Best hit to AAH26962 Unknown (protein for IMAGE:5103173), partial [Homo sapiens] by a BLASTP search against NCBI nr database. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
| mRNA evidence |
Transcript
| Transcript ID | pfu_aug1.0_505084.1_65113.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_505084.1_65113.t1 agagttcagacagtgaggtacctgatagggaacaagccaaggccttattgatggcgggtcgtcatctcccacctgctata ttaccatccaacgaggatcgtgtcacccttatatctgaggcaagcaagatgtatgaagtccttggtgataaaaaatcagt acagagctgccgtcgcgttctcatgcagtttgaaaacaat |
|
Protein
| Protein ID | pfu_aug1.0_505084.1_65113.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_505084.1_65113.t1 SSDSEVPDREQAKALLMAGRHLPPAILPSNEDRVTLISEASKMYEVLGDKKSVQSCRRVLMQFENN |
|