Gene
| Gene Model ID | pfu_aug1.0_58410.1_27444 |
|---|---|
| Locus | scaffold58410.1 : 1 ... 4021 : + |
| To GenomeBrowser | scaffold58410.1:1..4021 |
| Genes list of scaffold | scaffold58410.1 |
| Synonym | pfu_aug2.0_480.1_00800 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_58410.1_27444.t1 | 1 | 1 | cobW | 5 | 74 | 4.7e-12 | 45.7 | 6.6e-15 | 4.9e-12 | 45.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_58410.1_27444.t1 | gi|260790833|ref|XP_002590445.1| | hypothetical protein BRAFLDRAFT_124573 [Branchiostoma floridae] | 2.0e-34 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-4cell | 1 |
| 8-16cell | 2 |
| trochophore | 1 |
| >Adult tissues | |
Transcript
| Transcript ID | pfu_aug1.0_58410.1_27444.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_58410.1_27444.t1 cgagcattcactgttggggtaggtggtcccgtcgggtcggggaagactgctttggtattagccctctgtcagttcctgag ggagaagcacaatatatgtgtagtcaccaatgatattttcacaagagaagattgggaattcctagtgagaaacaaagcat tacctgaggagcgcatgcgcgctgtggaaacgggcggttgtccccatgccgctataagggaggtaatgaatgacgtaaaa taa |
|
Protein
| Protein ID | pfu_aug1.0_58410.1_27444.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_58410.1_27444.t1 RAFTVGVGGPVGSGKTALVLALCQFLREKHNICVVTNDIFTREDWEFLVRNKALPEERMRAVETGGCPHAAIREVMNDVK |
|