Genome browser

OIST Marine Genomics Unit since 2008

Gene
Gene Model IDpfu_aug1.0_62230.1_70938
Locus scaffold62230.1 : 1636 ... 3919 : +
To GenomeBrowser scaffold62230.1:1636..3919
Genes list of scaffold scaffold62230.1
Synonym pfu_aug2.0_8504.1_16328

Manual annotation
Hmmer Search for Pfam
query Total ID Target From To Eval Score cEval iEval Score
pfu_aug1.0_62230.1_70938.t1 2 1 EF-hand_1 1 19 8.6e-12 43.4 0.00026 0.55 9.6
pfu_aug1.0_62230.1_70938.t1 2 1 EF-hand_6 1 20 2.3e-09 36.3 0.00064 1.4 9.0
pfu_aug1.0_62230.1_70938.t1 1 1 EF-hand_7 1 51 2.3e-08 34.0 2.2e-11 4.8e-08 33.0
pfu_aug1.0_62230.1_70938.t1 2 1 EF-hand_5 8 18 1.3e-06 27.4 0.044 94.0 2.6
pfu_aug1.0_62230.1_70938.t1 1 1 EF-hand_8 10 51 8.1e-07 28.5 4.5e-10 9.6e-07 28.3
pfu_aug1.0_62230.1_70938.t1 2 2 EF-hand_1 30 55 8.6e-12 43.4 4.6e-12 9.8e-09 33.8
pfu_aug1.0_62230.1_70938.t1 2 2 EF-hand_6 31 55 2.3e-09 36.3 7.3e-10 1.6e-06 27.5
pfu_aug1.0_62230.1_70938.t1 2 2 EF-hand_5 32 50 1.3e-06 27.4 1.1e-09 2.2e-06 26.7

Blast Hit to nr / sp
query Subject ID Subject Name evalue
pfu_aug1.0_62230.1_70938.t1 gi|313224259|emb|CBY20048.1| unnamed protein product [Oikopleura dioica] 7.0e-11

Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)

Libraries EST count
>Embryonic/Larval stages
mix 1
egg-4cell 1
8-16cell 1
egg-Dshape 2
trochophore 2
>Adult tissues
Dshape 2

Transcript
Transcript IDpfu_aug1.0_62230.1_70938.t1
Definition-
>pfu_aug1.0_62230.1_70938.t1
atggatgatgatagtgatcggagtctcagcattagcgaattcaagaaaggtttacacgattatggagtggatgtggaagg
caatgtagcacaagaaatatttagtagaattgacaaggatggcagtggccaattatcttttgatgaatttttgatggcat
taagg

Protein
Protein IDpfu_aug1.0_62230.1_70938.t1
Definition-
>pfu_aug1.0_62230.1_70938.t1
MDDDSDRSLSISEFKKGLHDYGVDVEGNVAQEIFSRIDKDGSGQLSFDEFLMALR

  • MGU Home
  • Genome Projects
  • Information
  • Genome Browser
  • Blast Search
  • Keyword Search
  • Downloads

Gene ID:



Keyword:



  • Login

copyright © Marine Genomics Unit 2015
Okinawa Institute of Science and Technology
1919-1 Tancha, Onna-son, Kunigami-gun, Okinawa, Japan 904-0495