Gene
| Gene Model ID | pfu_aug1.0_6803.1_24087 |
|---|---|
| Locus | scaffold6803.1 : 4936 ... 10414 : + |
| To GenomeBrowser | scaffold6803.1:4936..10414 |
| Genes list of scaffold | scaffold6803.1 |
| Synonym | pfu_aug2.0_54.1_13500 |
Manual annotation
| Study field | structural proteins |
|---|---|
| Gene name | myosin essential light chain |
| Description | Myosin essential light chain partial sequence. BLASTP top hit to AJ563458(Crassostrea gigas). |
| mRNA evidence |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_6803.1_24087.t1 | 2 | 1 | EF-hand_1 | 2 | 27 | 7.8e-07 | 27.9 | 4.8e-09 | 8.8e-06 | 24.6 |
| pfu_aug1.0_6803.1_24087.t1 | 1 | 1 | EF-hand_6 | 2 | 28 | 3.4e-06 | 26.4 | 5.0e-09 | 9.2e-06 | 25.1 |
| pfu_aug1.0_6803.1_24087.t1 | 1 | 1 | EF-hand_7 | 2 | 60 | 9.4e-11 | 41.6 | 6.0e-14 | 1.1e-10 | 41.4 |
| pfu_aug1.0_6803.1_24087.t1 | 2 | 1 | EF-hand_8 | 4 | 19 | 2.4e-07 | 30.2 | 0.00061 | 1.1 | 8.8 |
| pfu_aug1.0_6803.1_24087.t1 | 2 | 2 | EF-hand_8 | 12 | 59 | 2.4e-07 | 30.2 | 5.6e-09 | 1.0e-05 | 25.0 |
| pfu_aug1.0_6803.1_24087.t1 | 2 | 2 | EF-hand_1 | 51 | 59 | 7.8e-07 | 27.9 | 0.16 | 300.0 | 1.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_6803.1_24087.t1 | gi|40642994|emb|CAD91423.1| | myosin essential light chain [Crassostrea gigas] | 1.0e-32 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 7 |
| egg-Dshape | 2 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 1 |
| adductorMuscle | 4 |
| maleGonad | 1 |
| mantle | 1 |
| mantleEdge | 1 |
| mantlePallium | 1 |
| pearlSac | 1 |
Transcript
| Transcript ID | pfu_aug1.0_6803.1_24087.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_6803.1_24087.t1 atggaagctttcaagactttcgacagggaaggtcaaggttacatttccggcgctgaacttaggcatcttctgtcttcttt gggagagaggttgaccgatgatcaggtggacgagatcattaggaatactgacttgcaagaagatttggaaggaaatgtca aatatgaagaatttatcaagaaagtgatggccggcccatacccagattaa |
|
Protein
| Protein ID | pfu_aug1.0_6803.1_24087.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_6803.1_24087.t1 MEAFKTFDREGQGYISGAELRHLLSSLGERLTDDQVDEIIRNTDLQEDLEGNVKYEEFIKKVMAGPYPD |
|