Gene
| Gene Model ID | pfu_aug1.0_78846.1_56571 |
|---|---|
| Locus | scaffold78846.1 : 35 ... 1225 : - |
| To GenomeBrowser | scaffold78846.1:35..1225 |
| Genes list of scaffold | scaffold78846.1 |
| Synonym | pfu_aug2.0_2029.1_32015 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_78846.1_56571.t1 | 1 | 1 | DUF4500 | 1 | 69 | 2.1e-22 | 78.7 | 3.1e-26 | 2.3e-22 | 78.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_78846.1_56571.t1 | gi|350423950|ref|XP_003493642.1| | PREDICTED: small integral membrane protein 8 [Bombus impatiens] | 1.0e-11 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| egg-4cell | 1 |
| >Adult tissues | |
| pearlSac | 1 |
Transcript
| Transcript ID | pfu_aug1.0_78846.1_56571.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_78846.1_56571.t1 atgcaaagcacctcggcattcagggccataaactttgagctttatgtaaaacctaacacccgtgtgtcgattcttggagg cttgatgttttttggttgccttggatatatagtgtatatgaacatctctgataaggacaaagggaatacttacactgcca taaacgaggatgggagtctcacacggcgagttaggacatcaaagtgggattga |
|
Protein
| Protein ID | pfu_aug1.0_78846.1_56571.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_78846.1_56571.t1 MQSTSAFRAINFELYVKPNTRVSILGGLMFFGCLGYIVYMNISDKDKGNTYTAINEDGSLTRRVRTSKWD |
|