Gene
| Gene Model ID | pfu_aug1.0_95962.1_06230 |
|---|---|
| Locus | scaffold95962.1 : 1 ... 1548 : - |
| To GenomeBrowser | scaffold95962.1:1..1548 |
| Genes list of scaffold | scaffold95962.1 |
| Synonym | pfu_aug2.0_224.1_13824 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug1.0_95962.1_06230.t1 | 1 | 1 | Complex1_30kDa | 53 | 124 | 8.7e-14 | 51.6 | 1.6e-17 | 1.2e-13 | 51.1 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_95962.1_06230.t1 | gi|225709662|gb|ACO10677.1| | NADH dehydrogenase iron-sulfur protein 3, mitochondrial precursor [Caligus rogercresseyi] | 2.0e-38 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 2 |
| egg-4cell | 1 |
| egg-Dshape | 2 |
| trochophore | 1 |
| >Adult tissues | |
| Dshape | 2 |
| adductorMuscle | 1 |
| maleGonad | 1 |
| mantle | 1 |
Transcript
| Transcript ID | pfu_aug1.0_95962.1_06230.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_95962.1_06230.t1 atgagacctccagtaaatcccttggtcaaagagaggctgtcggactttggtgtctacgtggcggagaatctacagaagtt tgtacagaaagtcagaatcgctaacggagatgaattagagatcctcgttcatcctgacggcattaaaacaacgctcctgt tcctgaagagtcatcatacctgtgaattccttaacattgttgatattgcctgtgtagatgttccaacgagaagatacaga tttgagttggtatataacttaatgtccctgaagcacaacacaaggatccgagtccattcctatacagacgaacttacacc ggtggagtcggtgatcgatgtatttatgggagcagattggtacgaaagggag |
|
Protein
| Protein ID | pfu_aug1.0_95962.1_06230.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_95962.1_06230.t1 MRPPVNPLVKERLSDFGVYVAENLQKFVQKVRIANGDELEILVHPDGIKTTLLFLKSHHTCEFLNIVDIACVDVPTRRYR FELVYNLMSLKHNTRIRVHSYTDELTPVESVIDVFMGADWYERE |
|