Gene
| Gene Model ID | pfu_aug1.0_9915.1_31847 |
|---|---|
| Locus | scaffold9915.1 : 2758 ... 27495 : - |
| To GenomeBrowser | scaffold9915.1:2758..27495 |
| Genes list of scaffold | scaffold9915.1 |
| Synonym | NA |
Manual annotation
| Study field | Transcription Factors |
|---|---|
| Gene name | Pfu-Max |
| Description | Best hit to AAQ57210 MAX protein [Homo sapiens] with 4e-19 by a BLASTP search against NCBI Homo sapiens nr database. This annotation is based on NJ, ML, and BI. EST assembled sequence was used for analyses. |
| mRNA evidence | pfudtrochophorec01675g00511 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug1.0_9915.1_31847.t1 | gi|47230248|emb|CAG10662.1| | unnamed protein product, partial [Tetraodon nigroviridis] | 4.0e-12 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)| Libraries | EST count |
|---|---|
| >Embryonic/Larval stages | |
| mix | 1 |
| >Adult tissues | |
Transcript
| Transcript ID | pfu_aug1.0_9915.1_31847.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_9915.1_31847.t1 atggggtcgcggccctatgcgattgggaaaattaacgacattttggaatattttgggaagtacatagataaaagtaacag gactttgaaggtatcaagagcccaaattctcaagaaggcagctgattacatttcctttatgagaaggaaaaatcatgggc accagcaggatatcgatgatttgaaaaaacaaaatgctatattagaacaacaaaataattga |
|
Protein
| Protein ID | pfu_aug1.0_9915.1_31847.t1 |
|---|---|
| Definition | - |
>pfu_aug1.0_9915.1_31847.t1 MGSRPYAIGKINDILEYFGKYIDKSNRTLKVSRAQILKKAADYISFMRRKNHGHQQDIDDLKKQNAILEQQNN |
|