Gene
| Gene Model ID | pfu_aug2.0_11.1_03378 |
|---|---|
| Locus | scaffold11.1 : 115084 ... 127895 : - |
| To GenomeBrowser | scaffold11.1:115084..127895 |
| Genes list of scaffold | scaffold11.1 |
| Synonym | pfu_aug1.0_501.1_50916 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_11.1_03378.t1 | 1 | 1 | PLAC8 | 5 | 97 | 1.3e-24 | 86.7 | 1.0e-28 | 1.5e-24 | 86.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_11.1_03378.t1 | gi|676438216|ref|XP_009048457.1| | hypothetical protein LOTGIDRAFT_238470 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_11.1_03378.t1 | gi|524885711|ref|XP_005099460.1| | PREDICTED: cell number regulator 10-like [Aplysia californica] | 8.0e-39 |
| pfu_aug2.0_11.1_03378.t1 | gi|676437241|ref|XP_009048139.1| | hypothetical protein LOTGIDRAFT_225418 [Lottia gigantea] | 6.0e-38 |
| pfu_aug2.0_11.1_03378.t1 | gi|676438959|ref|XP_009048701.1| | hypothetical protein LOTGIDRAFT_203561 [Lottia gigantea] | 1.0e-37 |
| pfu_aug2.0_11.1_03378.t1 | gi|156409347|ref|XP_001642131.1| | predicted protein [Nematostella vectensis] | 2.0e-37 |
Transcript
| Transcript ID | pfu_aug2.0_11.1_03378.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_11.1_03378.t1 atggcaggtgaatggcagcacggactttttggatgctttgacaattgcactatttgcatcatttcctacttcttgccatg ctaccagttcggaaaaaatgccgaagcggtgggtgaaagctgtttcatgtgcggccttgccttcttagtgccactagtgg atttgtacgccatcatcaaaatccgaggaaaaattcgggagacgaagggaattgagggcggccttgtaggcgacctgctc acatggtgcttctgtccgctatgtgcgttggttcaagaagctcaagaagtccagggtatggggccagccggtatcgcaat ggacagagaatga |
|
Protein
| Protein ID | pfu_aug2.0_11.1_03378.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_11.1_03378.t1 MAGEWQHGLFGCFDNCTICIISYFLPCYQFGKNAEAVGESCFMCGLAFLVPLVDLYAIIKIRGKIRETKGIEGGLVGDLL TWCFCPLCALVQEAQEVQGMGPAGIAMDRE |
|