Gene
| Gene Model ID | pfu_aug2.0_1153.1_11472 |
|---|---|
| Locus | scaffold1153.1 : 49907 ... 61565 : - |
| To GenomeBrowser | scaffold1153.1:49907..61565 |
| Genes list of scaffold | scaffold1153.1 |
| Synonym | pfu_aug1.0_5553.1_09143 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| peroxiredoxin- mitochondrial-like | GO:0016491 GO:0055114 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_1153.1_11472.t1 | 1 | 1 | Redoxin | 1 | 64 | 4.5e-11 | 42.4 | 3.1e-15 | 4.6e-11 | 42.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_1153.1_11472.t1 | gi|390367970|ref|XP_797550.3| | PREDICTED: peroxiredoxin-5, mitochondrial [Strongylocentrotus purpuratus] | 2.0e-31 |
| pfu_aug2.0_1153.1_11472.t1 | gi|410915322|ref|XP_003971136.1| | PREDICTED: peroxiredoxin-5, mitochondrial [Takifugu rubripes] | 1.0e-29 |
| pfu_aug2.0_1153.1_11472.t1 | gi|657569649|ref|XP_008288320.1| | PREDICTED: peroxiredoxin-5, mitochondrial [Stegastes partitus] | 2.0e-29 |
| pfu_aug2.0_1153.1_11472.t1 | gi|348526031|ref|XP_003450524.1| | PREDICTED: peroxiredoxin-5, mitochondrial-like [Oreochromis niloticus] | 2.0e-29 |
| pfu_aug2.0_1153.1_11472.t1 | gi|260837161|ref|XP_002613574.1| | hypothetical protein BRAFLDRAFT_119799 [Branchiostoma floridae] | 2.0e-29 |
Transcript
| Transcript ID | pfu_aug2.0_1153.1_11472.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1153.1_11472.t1 atggaggcatggggaaaagctcatgatgccacaggaaaggtacgaatgcttgccgacccagctggagaattcacgaaggc aattgattgtgcactagatgcgacagccatccttggtaatgtcagatctaaaagatactccatggttgtagaaaatggca aggtaacaaagtttaatttagaacctgacggtactggattaacgtgctctctagcacctgagattctcaaggaattgtag |
|
Protein
| Protein ID | pfu_aug2.0_1153.1_11472.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1153.1_11472.t1 MEAWGKAHDATGKVRMLADPAGEFTKAIDCALDATAILGNVRSKRYSMVVENGKVTKFNLEPDGTGLTCSLAPEILKEL |
|