Gene
Gene Model ID | pfu_aug2.0_1174.1_14840 |
---|---|
Locus | scaffold1174.1 : 40677 ... 41785 : - |
To GenomeBrowser | scaffold1174.1:40677..41785 |
Genes list of scaffold | scaffold1174.1 |
Synonym | NA |
Manual annotation
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug2.0_1174.1_14840.t1 | 1 | 1 | DUF2054 | 7 | 63 | 7.4e-17 | 61.4 | 5.9e-21 | 8.7e-17 | 61.2 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug2.0_1174.1_14840.t1 | gi|556994444|ref|XP_006001211.1| | PREDICTED: UPF0454 protein C12orf49 homolog isoform X1 [Latimeria chalumnae] | 5.0e-20 |
pfu_aug2.0_1174.1_14840.t1 | gi|528478594|ref|XP_005165101.1| | PREDICTED: UPF0454 protein C12orf49 homolog isoform X1 [Danio rerio] | 4.0e-19 |
pfu_aug2.0_1174.1_14840.t1 | gi|657573816|ref|XP_008290589.1| | PREDICTED: UPF0454 protein C12orf49 homolog [Stegastes partitus] | 6.0e-19 |
pfu_aug2.0_1174.1_14840.t1 | gi|66472238|ref|NP_001018573.1| | UPF0454 protein C12orf49 homolog precursor [Danio rerio] | 6.0e-19 |
pfu_aug2.0_1174.1_14840.t1 | gi|632968437|ref|XP_007900525.1| | PREDICTED: UPF0454 protein C12orf49 homolog [Callorhinchus milii] | 6.0e-19 |
Transcript
Transcript ID | pfu_aug2.0_1174.1_14840.t1 |
---|---|
Definition | - |
>pfu_aug2.0_1174.1_14840.t1 atgctgccttggaccagacaagagcgtccattacttcagaagattttaaccaatgctagggagacattagacattgctct tgggtcagcatcaaaccattttgacctttgtttggcaaagtgtagaacttcatctcagagtgttcaacatgagaattcct acagaaactcacttttaaagcattgttacggagaaaaccccccggaattacaacctctgtcttcatga |
Protein
Protein ID | pfu_aug2.0_1174.1_14840.t1 |
---|---|
Definition | - |
>pfu_aug2.0_1174.1_14840.t1 MLPWTRQERPLLQKILTNARETLDIALGSASNHFDLCLAKCRTSSQSVQHENSYRNSLLKHCYGENPPELQPLSS |