Gene
| Gene Model ID | pfu_aug2.0_1192.1_08224 |
|---|---|
| Locus | scaffold1192.1 : 4846 ... 12218 : + |
| To GenomeBrowser | scaffold1192.1:4846..12218 |
| Genes list of scaffold | scaffold1192.1 |
| Synonym | pfu_aug1.0_12161.1_17834 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| protein kish-a | GO:0000139 GO:0016021 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_1192.1_08224.t1 | 1 | 1 | DUF1242 | 10 | 44 | 5.7e-19 | 67.3 | 1.1e-22 | 7.9e-19 | 66.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_1192.1_08224.t1 | gi|675852680|ref|XP_009011900.1| | hypothetical protein HELRODRAFT_73116, partial [Helobdella robusta] | 7.0e-37 |
| pfu_aug2.0_1192.1_08224.t1 | gi|620941286|ref|XP_007654410.1| | PREDICTED: protein kish-A [Ornithorhynchus anatinus] | 1.0e-36 |
| pfu_aug2.0_1192.1_08224.t1 | gi|557321864|ref|XP_006034035.1| | PREDICTED: protein kish-A [Alligator sinensis] | 4.0e-36 |
| pfu_aug2.0_1192.1_08224.t1 | gi|543372570|ref|XP_005529505.1| | PREDICTED: protein kish-A [Pseudopodoces humilis] | 4.0e-36 |
| pfu_aug2.0_1192.1_08224.t1 | gi|602654702|ref|XP_007433162.1| | PREDICTED: protein kish-A-like [Python bivittatus] | 4.0e-36 |
Transcript
| Transcript ID | pfu_aug2.0_1192.1_08224.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1192.1_08224.t1 atgtccgccctattcaactttcaaagcctgttgacagtggttttactccttatctgtacatgcgcctacattcgctcaat agctccacgcctgctggataaaaataaaacaggggtattaggaacattttggaaatgtgcaagaataggtgaacgattga gtccgtatgttgccttatgctgtgtcggtatggcagtcagcatcttgttcctgacgtag |
|
Protein
| Protein ID | pfu_aug2.0_1192.1_08224.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1192.1_08224.t1 MSALFNFQSLLTVVLLLICTCAYIRSIAPRLLDKNKTGVLGTFWKCARIGERLSPYVALCCVGMAVSILFLT |
|