Gene
| Gene Model ID | pfu_aug2.0_1211.1_04894 |
|---|---|
| Locus | scaffold1211.1 : 168377 ... 180914 : - |
| To GenomeBrowser | scaffold1211.1:168377..180914 |
| Genes list of scaffold | scaffold1211.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| ubiquitin-conjugating enzyme e2 2-like isoform x1 | GO:0008152 GO:0016874 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_1211.1_04894.t1 | 1 | 1 | UQ_con | 1 | 102 | 1.4e-38 | 131.4 | 4.19969e-42 | 1.6e-38 | 131.3 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_1211.1_04894.t1 | gi|498989747|ref|XP_004552086.1| | PREDICTED: ubiquitin-conjugating enzyme E2 2-like isoform X1 [Maylandia zebra] | 0.0 |
| pfu_aug2.0_1211.1_04894.t1 | gi|348520306|ref|XP_003447669.1| | PREDICTED: ubiquitin-conjugating enzyme E2 2-like isoform X1 [Oreochromis niloticus] | 0.0 |
| pfu_aug2.0_1211.1_04894.t1 | gi|548397492|ref|XP_005737793.1| | PREDICTED: ubiquitin-conjugating enzyme E2 2-like isoform X3 [Pundamilia nyererei] | 0.0 |
| pfu_aug2.0_1211.1_04894.t1 | gi|734647097|ref|XP_010752718.1| | PREDICTED: ubiquitin-conjugating enzyme E2 2-like, partial [Larimichthys crocea] | 0.0 |
| pfu_aug2.0_1211.1_04894.t1 | gi|675859926|ref|XP_009015523.1| | hypothetical protein HELRODRAFT_184920 [Helobdella robusta] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_1211.1_04894.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1211.1_04894.t1 gaattgaatgagatttccaatgatccaccacctggatgttctgcagggcttgtaaatgaggatatgttcaactggcaggc tagtatagttggacctccggatagtccatatcagggaggtgtatatcaactaaatatactgtttcccacagattacccat tcaagccaccaaaaataacattcaagacaaagatttatcatccaaacattcattcaaatggaagtatatgtttagacatc cttagatctcagtggtccccagcactaactatatcaaaagagctgaaaaaaatgataggcgtgatccatgtagatgaaag cgaaagtagaacgccaattgtttttatgggttattaa |
|
Protein
| Protein ID | pfu_aug2.0_1211.1_04894.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1211.1_04894.t1 ELNEISNDPPPGCSAGLVNEDMFNWQASIVGPPDSPYQGGVYQLNILFPTDYPFKPPKITFKTKIYHPNIHSNGSICLDI LRSQWSPALTISKELKKMIGVIHVDESESRTPIVFMGY |
|