Gene
Gene Model ID | pfu_aug2.0_124.1_13643 |
---|---|
Locus | scaffold124.1 : 299581 ... 309035 : - |
To GenomeBrowser | scaffold124.1:299581..309035 |
Genes list of scaffold | scaffold124.1 |
Synonym | NA |
Manual annotation
Annotation by Blast2GO
Annotation | GO |
---|---|
meiosis expressed gene 1 protein homolog | GO:0005634 |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug2.0_124.1_13643.t1 | 1 | 1 | Meiosis_expr | 13 | 87 | 1.2e-33 | 115.2 | 1.9e-37 | 1.4e-33 | 115.0 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug2.0_124.1_13643.t1 | gi|676426862|ref|XP_009044760.1| | hypothetical protein LOTGIDRAFT_136043 [Lottia gigantea] | 1.0e-33 |
pfu_aug2.0_124.1_13643.t1 | gi|524889518|ref|XP_005101314.1| | PREDICTED: meiosis expressed gene 1 protein homolog isoform X1 [Aplysia californica] | 3.0e-31 |
pfu_aug2.0_124.1_13643.t1 | gi|156366845|ref|XP_001627132.1| | predicted protein [Nematostella vectensis] | 5.0e-31 |
pfu_aug2.0_124.1_13643.t1 | gi|221115424|ref|XP_002166591.1| | PREDICTED: meiosis expressed gene 1 protein homolog [Hydra vulgaris] | 8.0e-31 |
pfu_aug2.0_124.1_13643.t1 | gi|115733012|ref|XP_001175645.1| | PREDICTED: meiosis expressed gene 1 protein homolog [Strongylocentrotus purpuratus] | 5.0e-29 |
Transcript
Transcript ID | pfu_aug2.0_124.1_13643.t1 |
---|---|
Definition | - |
>pfu_aug2.0_124.1_13643.t1 atggcaactgtacagacacccatggagccatgtggaatggtcagacctaaatcatgggatgataaagtagaggaggcata tagatttcagttggcaggatacagggatgaaagggaatatgcacatctaacacaagctaatgtagaaagatggccacaca atggatatataaagaagttaatcaggaaagatggatgttggtattacttcaataaaaccagagagtgttcagaaaaagat gtatcaaagtgcaaattgtattcatatagtcaggataagtga |
Protein
Protein ID | pfu_aug2.0_124.1_13643.t1 |
---|---|
Definition | - |
>pfu_aug2.0_124.1_13643.t1 MATVQTPMEPCGMVRPKSWDDKVEEAYRFQLAGYRDEREYAHLTQANVERWPHNGYIKKLIRKDGCWYYFNKTRECSEKD VSKCKLYSYSQDK |