Gene
| Gene Model ID | pfu_aug2.0_12515.1_19779 |
|---|---|
| Locus | scaffold12515.1 : 1 ... 3945 : + |
| To GenomeBrowser | scaffold12515.1:1..3945 |
| Genes list of scaffold | scaffold12515.1 |
| Synonym | pfu_aug1.0_408.1_50848 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| protein red | GO:0005634 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_12515.1_19779.t1 | 2 | 1 | RED_N | 1 | 132 | 6.0e-37 | 127.1 | 1.2e-40 | 6.0e-37 | 127.1 |
| pfu_aug2.0_12515.1_19779.t1 | 2 | 2 | RED_N | 163 | 194 | 6.0e-37 | 127.1 | 3.0 | 15000.0 | -5.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_12515.1_19779.t1 | gi|676449333|ref|XP_009052021.1| | hypothetical protein LOTGIDRAFT_214293 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_12515.1_19779.t1 | gi|545490366|ref|XP_005617342.1| | PREDICTED: protein Red isoform X1 [Canis lupus familiaris] | 0.0 |
| pfu_aug2.0_12515.1_19779.t1 | gi|73949335|ref|XP_848793.1| | PREDICTED: protein Red isoform X2 [Canis lupus familiaris] | 0.0 |
| pfu_aug2.0_12515.1_19779.t1 | gi|472356382|ref|XP_004397831.1| | PREDICTED: protein Red [Odobenus rosmarus divergens] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_12515.1_19779.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_12515.1_19779.t1 gtaagggcagaaattagttacaaagagagagaagaagaagaaacaatggaggaagtagtggataaaaaagaagaaaaaga agctgagccagaagaacagattcagttcaaaaccaaaatggggaggaatatctacaggactctgttcaagcagaaacagc cggagaggaatgagttgttcttacctagacgtatggcgtacgtagtagacattgaggatgaatttgccgacagtgatgtt cccacaacaacaattcgaagcaaggctgattgtccaacacttgaggctaatgccactctgacaaccaatgatattgtcat caacaaactgacacagatcttatcctacctcagacagggaaggcgagaaaacaaaaaactcaaaaagaaagaaaaaggta aaataaaagaggaggataaggccagagagaagcttccaggagctgatatggatatatacacagacctggctgactataat ccttactctaaatcatctaaggacaaaaaagagaagaaggatcgtgaccgaggggatgatcatagagaccgaggcagaga cagggaccgtggtgatagggatagggagagggactatag |
|
Protein
| Protein ID | pfu_aug2.0_12515.1_19779.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_12515.1_19779.t1 VRAEISYKEREEEETMEEVVDKKEEKEAEPEEQIQFKTKMGRNIYRTLFKQKQPERNELFLPRRMAYVVDIEDEFADSDV PTTTIRSKADCPTLEANATLTTNDIVINKLTQILSYLRQGRRENKKLKKKEKGKIKEEDKAREKLPGADMDIYTDLADYN PYSKSSKDKKEKKDRDRGDDHRDRGRDRDRGDRDRERDY |
|