Gene
Gene Model ID | pfu_aug2.0_1255.1_18214 |
---|---|
Locus | scaffold1255.1 : 94262 ... 97785 : - |
To GenomeBrowser | scaffold1255.1:94262..97785 |
Genes list of scaffold | scaffold1255.1 |
Synonym | pfu_aug1.0_1966.1_29918 |
Manual annotation
Annotation by Blast2GO
Annotation | GO |
---|---|
lim-type zinc finger-containing protein | GO:0016049 GO:0044707 GO:0046872 GO:0048869 GO:0051015 GO:0051017 GO:0060560 |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug2.0_1255.1_18214.t1 | 1 | 1 | LIM | 9 | 63 | 4.5e-10 | 39.4 | 7.2e-14 | 5.4e-10 | 39.1 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug2.0_1255.1_18214.t1 | gi|676484661|ref|XP_009063411.1| | hypothetical protein LOTGIDRAFT_221100 [Lottia gigantea] | 5.0e-27 |
pfu_aug2.0_1255.1_18214.t1 | gi|524863982|ref|XP_005088830.1| | PREDICTED: cysteine and glycine-rich protein 3-like [Aplysia californica] | 6.0e-25 |
pfu_aug2.0_1255.1_18214.t1 | gi|675858724|ref|XP_009014922.1| | hypothetical protein HELRODRAFT_110893 [Helobdella robusta] | 6.0e-24 |
pfu_aug2.0_1255.1_18214.t1 | gi|514689887|ref|XP_004992518.1| | LIM-type zinc finger-containing protein [Salpingoeca rosetta] | 2.0e-15 |
pfu_aug2.0_1255.1_18214.t1 | gi|156408854|ref|XP_001642071.1| | predicted protein [Nematostella vectensis] | 3.0e-14 |
Transcript
Transcript ID | pfu_aug2.0_1255.1_18214.t1 |
---|---|
Definition | - |
>pfu_aug2.0_1255.1_18214.t1 atgccatttggtggtggagaaaagtgtggggtgtgtgcgaagtcggtgtatgctgcggagagacaagaggctgggaaaat catataccataaattctgcttcaaatgcagtgaatgtaagatgcaattaaatttgaacaactacgctcaggctgatggaa taatattctgtaaaaagcatttccaggagtgtgtagtagctaagaatacccagacacctattgtttga |
Protein
Protein ID | pfu_aug2.0_1255.1_18214.t1 |
---|---|
Definition | - |
>pfu_aug2.0_1255.1_18214.t1 MPFGGGEKCGVCAKSVYAAERQEAGKIIYHKFCFKCSECKMQLNLNNYAQADGIIFCKKHFQECVVAKNTQTPIV |