Gene
| Gene Model ID | pfu_aug2.0_130.1_00288 |
|---|---|
| Locus | scaffold130.1 : 137018 ... 145295 : - |
| To GenomeBrowser | scaffold130.1:137018..145295 |
| Genes list of scaffold | scaffold130.1 |
| Synonym | pfu_aug1.0_2096.1_37218 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| 60s ribosomal protein l38 | GO:0000184 GO:0001501 GO:0001503 GO:0003723 GO:0003735 GO:0005925 GO:0006413 GO:0006414 GO:0006415 GO:0006417 GO:0006614 GO:0007605 GO:0019083 GO:0022625 GO:0033291 GO:0034463 GO:0042474 GO:0043009 GO:0048318 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_130.1_00288.t1 | 1 | 1 | Ribosomal_L38e | 2 | 69 | 3.7e-34 | 116.2 | 5.4e-38 | 4.0e-34 | 116.1 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_130.1_00288.t1 | gi|524884364|ref|XP_005098803.1| | PREDICTED: 60S ribosomal protein L38-like isoform X2 [Aplysia californica] | 3.0e-39 |
| pfu_aug2.0_130.1_00288.t1 | gi|524884362|ref|XP_005098802.1| | PREDICTED: 60S ribosomal protein L38-like isoform X1 [Aplysia californica] | 6.0e-39 |
| pfu_aug2.0_130.1_00288.t1 | gi|260824537|ref|XP_002607224.1| | hypothetical protein BRAFLDRAFT_286891 [Branchiostoma floridae] | 1.0e-38 |
| pfu_aug2.0_130.1_00288.t1 | gi|676428351|ref|XP_009045247.1| | hypothetical protein LOTGIDRAFT_211882 [Lottia gigantea] | 1.0e-37 |
| pfu_aug2.0_130.1_00288.t1 | gi|675850654|ref|XP_009010887.1| | hypothetical protein HELRODRAFT_185258 [Helobdella robusta] | 2.0e-37 |
Transcript
| Transcript ID | pfu_aug2.0_130.1_00288.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_130.1_00288.t1 atgccaaagcagatccaagaaataaaagatttcctgttgacagccaggaggaaggatgccaaatctgttaaaatcaagaa gaataaggagaatgtgaaattcaaggtgcgatgcagtcggtatctctacacactggtcatcagtgatcgggaaaaggctg acaaactcagacagtccctcccaccaggtttggcagtaaaagaactcaagtaa |
|
Protein
| Protein ID | pfu_aug2.0_130.1_00288.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_130.1_00288.t1 MPKQIQEIKDFLLTARRKDAKSVKIKKNKENVKFKVRCSRYLYTLVISDREKADKLRQSLPPGLAVKELK |
|