Gene
| Gene Model ID | pfu_aug2.0_13172.1_09846 |
|---|---|
| Locus | scaffold13172.1 : 3150 ... 3524 : - |
| To GenomeBrowser | scaffold13172.1:3150..3524 |
| Genes list of scaffold | scaffold13172.1 |
| Synonym | pfu_aug1.0_2344.1_15793 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| major facilitator superfamily domain-containing protein 8 isoform x1 | GO:0005764 GO:0016021 GO:0055085 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_13172.1_09846.t1 | gi|260833032|ref|XP_002611461.1| | hypothetical protein BRAFLDRAFT_63906 [Branchiostoma floridae] | 1.0e-17 |
| pfu_aug2.0_13172.1_09846.t1 | gi|591332226|ref|XP_007091871.1| | PREDICTED: major facilitator superfamily domain-containing protein 8 [Panthera tigris altaica] | 2.0e-13 |
| pfu_aug2.0_13172.1_09846.t1 | gi|755722127|ref|XP_006930935.2| | PREDICTED: major facilitator superfamily domain-containing protein 8 isoform X1 [Felis catus] | 3.0e-13 |
| pfu_aug2.0_13172.1_09846.t1 | gi|558098073|ref|XP_006081737.1| | PREDICTED: major facilitator superfamily domain-containing protein 8 isoform X4 [Myotis lucifugus] | 2.0e-12 |
Transcript
| Transcript ID | pfu_aug2.0_13172.1_09846.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_13172.1_09846.t1 ggtacctggatggggtggttaacagcatcaggtagcctggcaagaactgtaggtcctatatttgtaagtcaggtgtataa ttcgtacggaccacgtgtgactttcatctctatgagcggcgtcgttcttttcactattggtggcttctgtggcatttata ggaaacttgtgccgttcaaattcatagacgacggagaatga |
|
Protein
| Protein ID | pfu_aug2.0_13172.1_09846.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_13172.1_09846.t1 GTWMGWLTASGSLARTVGPIFVSQVYNSYGPRVTFISMSGVVLFTIGGFCGIYRKLVPFKFIDDGE |
|