Gene
| Gene Model ID | pfu_aug2.0_14017.1_26471 |
|---|---|
| Locus | scaffold14017.1 : 1 ... 2976 : - |
| To GenomeBrowser | scaffold14017.1:1..2976 |
| Genes list of scaffold | scaffold14017.1 |
| Synonym | pfu_aug1.0_19411.1_61910 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| lim and senescent cell antigen-like-containing domain protein 2 | GO:0005634 GO:0005829 GO:0005886 GO:0005925 GO:0008152 GO:0008270 GO:0016337 GO:0016740 GO:0034329 GO:0043066 GO:0045216 GO:2000178 GO:2000346 GO:2001046 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_14017.1_26471.t1 | 2 | 1 | LIM | 1 | 27 | 6.0e-18 | 64.6 | 1.8e-08 | 5.5e-05 | 23.1 |
| pfu_aug2.0_14017.1_26471.t1 | 2 | 2 | LIM | 34 | 72 | 6.0e-18 | 64.6 | 3.8e-15 | 1.1e-11 | 44.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_14017.1_26471.t1 | gi|733902717|ref|XP_010714918.1| | PREDICTED: LIM and senescent cell antigen-like-containing domain protein 2 [Meleagris gallopavo] | 8.00001e-42 |
| pfu_aug2.0_14017.1_26471.t1 | gi|578804578|ref|XP_006712691.1| | PREDICTED: LIM and senescent cell antigen-like-containing domain protein 2 isoform X5 [Homo sapiens] | 9.99967e-42 |
| pfu_aug2.0_14017.1_26471.t1 | gi|686706276|ref|XP_009234506.1| | PREDICTED: LOW QUALITY PROTEIN: LIM and senescent cell antigen-like-containing domain protein 3-like [Pongo abelii] | 4.00001e-41 |
| pfu_aug2.0_14017.1_26471.t1 | gi|640792047|ref|XP_008051933.1| | PREDICTED: LIM and senescent cell antigen-like-containing domain protein 2 [Tarsius syrichta] | 8.00001e-41 |
| pfu_aug2.0_14017.1_26471.t1 | gi|241609867|ref|XP_002406849.1| | LIM domain-containing protein, putative [Ixodes scapularis] | 8.99998e-41 |
Transcript
| Transcript ID | pfu_aug2.0_14017.1_26471.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_14017.1_26471.t1 atgtgcccagtgcttccagccttttcctgatggtgtcttctatgagtttgaaggccgaaagtactgtgagcatgactttc aagttctttttgccccatgctgtgcaaaatgtggtgaattcatcattggccgagttattaaggcgatgaacaagagctgg catcctgactgttttcgttgtgagctttgtgaagctccgttggcagatgctggattcgtgaagaatgctggaag |
|
Protein
| Protein ID | pfu_aug2.0_14017.1_26471.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_14017.1_26471.t1 CAQCFQPFPDGVFYEFEGRKYCEHDFQVLFAPCCAKCGEFIIGRVIKAMNKSWHPDCFRCELCEAPLADAGFVKNAG |
|