Gene
| Gene Model ID | pfu_aug2.0_1557.1_25004 |
|---|---|
| Locus | scaffold1557.1 : 106688 ... 114565 : - |
| To GenomeBrowser | scaffold1557.1:106688..114565 |
| Genes list of scaffold | scaffold1557.1 |
| Synonym | NA |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| calmodulin- partial | GO:0015630 GO:0019899 GO:0044093 GO:0044430 GO:0044707 GO:0044763 GO:0045937 GO:0046872 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_1557.1_25004.t1 | 2 | 1 | EF-hand_1 | 16 | 43 | 6.8e-11 | 40.6 | 9.1e-11 | 1.7e-07 | 30.0 |
| pfu_aug2.0_1557.1_25004.t1 | 1 | 1 | EF-hand_7 | 16 | 75 | 2.3e-10 | 40.4 | 1.8e-13 | 3.3e-10 | 39.9 |
| pfu_aug2.0_1557.1_25004.t1 | 2 | 1 | EF-hand_6 | 16 | 43 | 2.4e-09 | 36.3 | 1.3e-10 | 2.4e-07 | 30.0 |
| pfu_aug2.0_1557.1_25004.t1 | 2 | 1 | EF-hand_8 | 19 | 36 | 2.2e-07 | 30.3 | 0.00044 | 0.82 | 9.3 |
| pfu_aug2.0_1557.1_25004.t1 | 2 | 2 | EF-hand_8 | 27 | 75 | 2.2e-07 | 30.3 | 2.9e-10 | 5.3e-07 | 29.1 |
| pfu_aug2.0_1557.1_25004.t1 | 2 | 2 | EF-hand_1 | 51 | 77 | 6.8e-11 | 40.6 | 0.00018 | 0.33 | 10.3 |
| pfu_aug2.0_1557.1_25004.t1 | 2 | 2 | EF-hand_6 | 63 | 77 | 2.4e-09 | 36.3 | 0.019 | 35.0 | 4.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_1557.1_25004.t1 | gi|524916219|ref|XP_005112891.1| | PREDICTED: calmodulin-like, partial [Aplysia californica] | 8.0e-18 |
| pfu_aug2.0_1557.1_25004.t1 | gi|291228246|ref|XP_002734091.1| | PREDICTED: calmodulin-like, partial [Saccoglossus kowalevskii] | 4.0e-17 |
Transcript
| Transcript ID | pfu_aug2.0_1557.1_25004.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1557.1_25004.t1 atgatggcttcccgtatcaacgcccctgtggactcacccaaagatctgatagaggcatttgagatgttcgatgaagataa gaaaggttttatatctatgtcagaattccggttagtaatgactaaaatgggtgaaaagctaccagaatctgaagtcgatg agatggtcagacttacgggtattggtaaaaatggaaaagtcaaatacagagaatttgtgaagattcttacttcgtga |
|
Protein
| Protein ID | pfu_aug2.0_1557.1_25004.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1557.1_25004.t1 MMASRINAPVDSPKDLIEAFEMFDEDKKGFISMSEFRLVMTKMGEKLPESEVDEMVRLTGIGKNGKVKYREFVKILTS |
|