Gene
| Gene Model ID | pfu_aug2.0_15905.1_19874 |
|---|---|
| Locus | scaffold15905.1 : 1 ... 2190 : - |
| To GenomeBrowser | scaffold15905.1:1..2190 |
| Genes list of scaffold | scaffold15905.1 |
| Synonym | pfu_aug1.0_3370.1_59213 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_15905.1_19874.t1 | 1 | 1 | F5_F8_type_C | 6 | 87 | 3.3e-11 | 43.1 | 2.6e-15 | 3.9e-11 | 42.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_15905.1_19874.t1 | gi|675772582|ref|XP_002763647.2| | PREDICTED: lactadherin-like [Callithrix jacchus] | 3.0e-13 |
| pfu_aug2.0_15905.1_19874.t1 | gi|675663118|ref|XP_002749201.2| | PREDICTED: lactadherin [Callithrix jacchus] | 3.0e-11 |
| pfu_aug2.0_15905.1_19874.t1 | gi|354501005|ref|XP_003512584.1| | PREDICTED: lactadherin isoform X1, partial [Cricetulus griseus] | 7.0e-11 |
| pfu_aug2.0_15905.1_19874.t1 | gi|395831234|ref|XP_003788710.1| | PREDICTED: lactadherin isoform X3 [Otolemur garnettii] | 2.0e-10 |
| pfu_aug2.0_15905.1_19874.t1 | gi|260827911|ref|XP_002608907.1| | hypothetical protein BRAFLDRAFT_85528 [Branchiostoma floridae] | 2.0e-10 |
Transcript
| Transcript ID | pfu_aug2.0_15905.1_19874.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_15905.1_19874.t1 ataagatcctcccgtactataacggtcactggtatgttggtacaaggggataaagacattggacaatgggtgacgtcact gatggtcaagtacagcatggactgctcggaattttactctatcatggatggtaggagagaaaaggtatttgctggaaatg tagatgctcaatcggatgccatggtggattttaacaatgtggtcgtagcacggtgtatcagggtgattcctgtagaacgt catggtaacaaaacagctctaagactcgatctacttggatgta |
|
Protein
| Protein ID | pfu_aug2.0_15905.1_19874.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_15905.1_19874.t1 IRSSRTITVTGMLVQGDKDIGQWVTSLMVKYSMDCSEFYSIMDGRREKVFAGNVDAQSDAMVDFNNVVVARCIRVIPVER HGNKTALRLDLLGC |
|