Gene
| Gene Model ID | pfu_aug2.0_1664.1_15179 |
|---|---|
| Locus | scaffold1664.1 : 1767 ... 2751 : + |
| To GenomeBrowser | scaffold1664.1:1767..2751 |
| Genes list of scaffold | scaffold1664.1 |
| Synonym | NA |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_1664.1_15179.t1 | 1 | 1 | Mpv17_PMP22 | 2 | 39 | 4.9e-13 | 48.5 | 4.7e-17 | 7.0e-13 | 48.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_1664.1_15179.t1 | gi|470300569|ref|XP_004346946.1| | Mpv17 protein [Capsaspora owczarzaki ATCC 30864] | 1.0e-07 |
| pfu_aug2.0_1664.1_15179.t1 | gi|631371854|ref|XP_007920307.1| | hypothetical protein MYCFIDRAFT_71100 [Pseudocercospora fijiensis CIRAD86] | 7.0e-07 |
| pfu_aug2.0_1664.1_15179.t1 | gi|296418712|ref|XP_002838969.1| | hypothetical protein [Tuber melanosporum Mel28] | 1.0e-06 |
| pfu_aug2.0_1664.1_15179.t1 | gi|308493745|ref|XP_003109062.1| | hypothetical protein CRE_11837 [Caenorhabditis remanei] | 1.0e-06 |
| pfu_aug2.0_1664.1_15179.t1 | gi|657761247|ref|XP_008315641.1| | PREDICTED: mpv17-like protein [Cynoglossus semilaevis] | 2.0e-06 |
Transcript
| Transcript ID | pfu_aug2.0_1664.1_15179.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1664.1_15179.t1 atgaagatctggccagcagtgcagctgattaactttagttttgtaccgatcgttcacagacctaaagtcatatcttgtgt gtcctttggatggtctatatatctgtgctttcagaaagaggacgcgcataatgagaataaagccgccatcagccccaccg tagagggggataaattagttatagccaacagtgtagttaacgtcacagatattaaaccatgttctgacactcagcctggt gttatgatcaggggaaaactcacagtaatggcagcaggaaaacacaaagactgtgtagaaaacaaagtgaaataa |
|
Protein
| Protein ID | pfu_aug2.0_1664.1_15179.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1664.1_15179.t1 MKIWPAVQLINFSFVPIVHRPKVISCVSFGWSIYLCFQKEDAHNENKAAISPTVEGDKLVIANSVVNVTDIKPCSDTQPG VMIRGKLTVMAAGKHKDCVENKVK |
|