Gene
| Gene Model ID | pfu_aug2.0_1734.1_15219 |
|---|---|
| Locus | scaffold1734.1 : 70116 ... 79195 : + |
| To GenomeBrowser | scaffold1734.1:70116..79195 |
| Genes list of scaffold | scaffold1734.1 |
| Synonym | NA |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_1734.1_15219.t1 | 1 | 1 | DUF543 | 6 | 66 | 2.7e-22 | 78.5 | 3.8e-26 | 2.8e-22 | 78.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_1734.1_15219.t1 | gi|676470154|ref|XP_009058763.1| | hypothetical protein LOTGIDRAFT_217865 [Lottia gigantea] | 4.0e-26 |
| pfu_aug2.0_1734.1_15219.t1 | gi|530599055|ref|XP_005293027.1| | PREDICTED: mitochondrial inner membrane organizing system protein 1 [Chrysemys picta bellii] | 5.0e-20 |
| pfu_aug2.0_1734.1_15219.t1 | gi|699657530|ref|XP_009897792.1| | PREDICTED: mitochondrial inner membrane organizing system protein 1 [Picoides pubescens] | 5.0e-20 |
| pfu_aug2.0_1734.1_15219.t1 | gi|507546986|ref|XP_004657403.1| | 7.0e-20 | |
| pfu_aug2.0_1734.1_15219.t1 | gi|383849232|ref|XP_003700249.1| | PREDICTED: MICOS complex subunit Mic10-like [Megachile rotundata] | 1.0e-19 |
Transcript
| Transcript ID | pfu_aug2.0_1734.1_15219.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1734.1_15219.t1 atgacggaaaaagtaaggtcggaggatgtccttgggttaaaatgggacagatgtgcaactgatcttattgttaagtcatg tggcggccttatccttggaggtactttctctgctctattcttcaaaagtaaattatggccgattacattaggtgttggaa tggggataggaatggcttactctaattgtcagaatgatgtacagaatcctggctactctaagagtagctga |
|
Protein
| Protein ID | pfu_aug2.0_1734.1_15219.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1734.1_15219.t1 MTEKVRSEDVLGLKWDRCATDLIVKSCGGLILGGTFSALFFKSKLWPITLGVGMGIGMAYSNCQNDVQNPGYSKSS |
|