Gene
| Gene Model ID | pfu_aug2.0_17623.1_13236 |
|---|---|
| Locus | scaffold17623.1 : 1 ... 1769 : - |
| To GenomeBrowser | scaffold17623.1:1..1769 |
| Genes list of scaffold | scaffold17623.1 |
| Synonym | pfu_aug1.0_21201.1_18779 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| sodium-coupled neutral amino acid transporter 10 | GO:0016021 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_17623.1_13236.t1 | 1 | 1 | Aa_trans | 19 | 68 | 8.9e-08 | 31.0 | 6.0e-12 | 8.9e-08 | 31.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_17623.1_13236.t1 | gi|524882894|ref|XP_005098083.1| | PREDICTED: putative sodium-coupled neutral amino acid transporter 10-like [Aplysia californica] | 5.0e-19 |
| pfu_aug2.0_17623.1_13236.t1 | gi|676429169|ref|XP_009045512.1| | hypothetical protein LOTGIDRAFT_109866 [Lottia gigantea] | 1.0e-17 |
| pfu_aug2.0_17623.1_13236.t1 | gi|571550688|ref|XP_006567533.1| | PREDICTED: putative sodium-coupled neutral amino acid transporter 10-like isoform X2 [Apis mellifera] | 3.0e-14 |
| pfu_aug2.0_17623.1_13236.t1 | gi|340718122|ref|XP_003397521.1| | 3.0e-14 | |
| pfu_aug2.0_17623.1_13236.t1 | gi|328788015|ref|XP_003251042.1| | PREDICTED: putative sodium-coupled neutral amino acid transporter 10-like isoform X1 [Apis mellifera] | 8.0e-14 |
Transcript
| Transcript ID | pfu_aug2.0_17623.1_13236.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_17623.1_13236.t1 agaccaaagcattcagaggatatagaatccagaccagtcattccagaaatccattttaaagcactaactgttgccatagt agctgttgccatgacaacaggagtattagtaccaaatgttgagtttgtactggccatgaacggagctacaatggggacac tgatttgttacacttttcctgccatattttttctgagggttatgactggtacca |
|
Protein
| Protein ID | pfu_aug2.0_17623.1_13236.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_17623.1_13236.t1 RPKHSEDIESRPVIPEIHFKALTVAIVAVAMTTGVLVPNVEFVLAMNGATMGTLICYTFPAIFFLRVMTGT |
|