Gene
| Gene Model ID | pfu_aug2.0_193.1_10410 |
|---|---|
| Locus | scaffold193.1 : 142736 ... 144015 : + |
| To GenomeBrowser | scaffold193.1:142736..144015 |
| Genes list of scaffold | scaffold193.1 |
| Synonym | pfu_aug1.0_72480.1_41943 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| prolactin-releasing peptide receptor | GO:0004983 GO:0007218 GO:0016021 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_193.1_10410.t1 | 1 | 1 | 7tm_1 | 2 | 53 | 6.8e-07 | 28.6 | 6.3e-11 | 9.4e-07 | 28.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_193.1_10410.t1 | gi|524911910|ref|XP_005110813.1| | PREDICTED: bombesin receptor subtype-3-like [Aplysia californica] | 3.0e-35 |
| pfu_aug2.0_193.1_10410.t1 | gi|676452301|ref|XP_009052988.1| | hypothetical protein LOTGIDRAFT_174874 [Lottia gigantea] | 2.0e-33 |
| pfu_aug2.0_193.1_10410.t1 | gi|755952234|ref|XP_011302024.1| | PREDICTED: prolactin-releasing peptide receptor [Fopius arisanus] | 1.0e-20 |
| pfu_aug2.0_193.1_10410.t1 | gi|645001591|ref|XP_008209596.1| | PREDICTED: prolactin-releasing peptide receptor [Nasonia vitripennis] | 8.0e-18 |
| pfu_aug2.0_193.1_10410.t1 | gi|665790597|ref|XP_008560991.1| | PREDICTED: uncharacterized protein LOC103580861 isoform X2 [Microplitis demolitor] | 9.0e-17 |
Transcript
| Transcript ID | pfu_aug2.0_193.1_10410.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_193.1_10410.t1 atggtcaccttatttgcaatttgctggtgcccaatgaacattcttattctagttcagtatgtggttcacgaaaatggcga caacaccggacattttgacatcacatacataacattcacattatttggtttcctttctacctgtgtgaaccctgtactgt ttgcctcgtggaggatgtcggagacaacaaaggatcgattaaggggatatttccgcttcaacatcaaaagggtccaccat aaaagaaaaccaaactctttcaaagaagaagcaaacggcaatagaagccgtcgaaaggaggaatatatccgagacgaaat gcatcggttgccttcctga |
|
Protein
| Protein ID | pfu_aug2.0_193.1_10410.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_193.1_10410.t1 MVTLFAICWCPMNILILVQYVVHENGDNTGHFDITYITFTLFGFLSTCVNPVLFASWRMSETTKDRLRGYFRFNIKRVHH KRKPNSFKEEANGNRSRRKEEYIRDEMHRLPS |
|