Gene
| Gene Model ID | pfu_aug2.0_2029.1_32015 |
|---|---|
| Locus | scaffold2029.1 : 42406 ... 43231 : + |
| To GenomeBrowser | scaffold2029.1:42406..43231 |
| Genes list of scaffold | scaffold2029.1 |
| Synonym | pfu_aug1.0_78846.1_56571 |
Manual annotation
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_2029.1_32015.t1 | 1 | 1 | DUF4500 | 21 | 104 | 2.3e-25 | 88.2 | 2.0e-29 | 3.0e-25 | 87.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_2029.1_32015.t1 | gi|524883713|ref|XP_005098483.1| | PREDICTED: small integral membrane protein 8-like [Aplysia californica] | 3.0e-21 |
| pfu_aug2.0_2029.1_32015.t1 | gi|676450402|ref|XP_009052367.1| | hypothetical protein LOTGIDRAFT_203775 [Lottia gigantea] | 5.0e-21 |
| pfu_aug2.0_2029.1_32015.t1 | gi|675872970|ref|XP_009022045.1| | hypothetical protein HELRODRAFT_83983 [Helobdella robusta] | 5.0e-19 |
| pfu_aug2.0_2029.1_32015.t1 | gi|699245629|ref|XP_009859509.1| | PREDICTED: small integral membrane protein 8-like [Ciona intestinalis] | 7.0e-19 |
| pfu_aug2.0_2029.1_32015.t1 | gi|350423950|ref|XP_003493642.1| | PREDICTED: small integral membrane protein 8 [Bombus impatiens] | 6.0e-18 |
Transcript
| Transcript ID | pfu_aug2.0_2029.1_32015.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2029.1_32015.t1 atgagtgaagacaaaacacaatcaacaaacagtgtagccacagaaacgaaagacacaaataaaacaacgacaacaacaaa aagagagggcggaggatggcgtcaaatgcaaagcacctcggcattcagggccataaactttgagctttatgtaaaaccta acacccgtgtgtcgattcttggaggcttgatgttttttggttgccttggatatatagtgtatatgaacatctctgataag gacaaagggaatacttacactgccataaacgaggatgggagtctcacacggcgagttaggacatcaaagtgggattga |
|
Protein
| Protein ID | pfu_aug2.0_2029.1_32015.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2029.1_32015.t1 MSEDKTQSTNSVATETKDTNKTTTTTKREGGGWRQMQSTSAFRAINFELYVKPNTRVSILGGLMFFGCLGYIVYMNISDK DKGNTYTAINEDGSLTRRVRTSKWD |
|