Gene
| Gene Model ID | pfu_aug2.0_2135.1_18703 |
|---|---|
| Locus | scaffold2135.1 : 105223 ... 107535 : - |
| To GenomeBrowser | scaffold2135.1:105223..107535 |
| Genes list of scaffold | scaffold2135.1 |
| Synonym | pfu_aug1.0_61723.1_20306 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| anaphase-promoting complex subunit 13 | GO:0005680 GO:0007067 GO:0051301 GO:0070979 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_2135.1_18703.t1 | 1 | 1 | Apc13p | 1 | 70 | 2.2e-13 | 50.0 | 2.5e-17 | 3.6e-13 | 49.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_2135.1_18703.t1 | gi|676473297|ref|XP_009059772.1| | hypothetical protein LOTGIDRAFT_218795 [Lottia gigantea] | 2.0e-25 |
| pfu_aug2.0_2135.1_18703.t1 | gi|62857787|ref|NP_001017240.1| | anaphase-promoting complex subunit 13 [Xenopus (Silurana) tropicalis] | 4.0e-24 |
| pfu_aug2.0_2135.1_18703.t1 | gi|241739851|ref|XP_002405168.1| | anaphase-promoting complex subunit, putative [Ixodes scapularis] | 5.0e-24 |
| pfu_aug2.0_2135.1_18703.t1 | gi|284520952|ref|NP_001165256.1| | anaphase promoting complex subunit 13, gene 2 [Xenopus laevis] | 2.0e-23 |
| pfu_aug2.0_2135.1_18703.t1 | gi|705658791|ref|XP_010117977.1| | PREDICTED: anaphase-promoting complex subunit 13 [Chlamydotis macqueenii] | 3.0e-22 |
Transcript
| Transcript ID | pfu_aug2.0_2135.1_18703.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2135.1_18703.t1 atggacagccaggttgtgagggacggtaaactgatggagattatagatgaagaatggaggaaagataaacttcccatgga agatatacaggtcccagagatggaattacccgagccagagccggacaacggaccgtccagtgaaactctgaaagaacaag aggctaaatggatggatctagcactgtccactctacatgaccaacaggcatcgagtacatctcactga |
|
Protein
| Protein ID | pfu_aug2.0_2135.1_18703.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2135.1_18703.t1 MDSQVVRDGKLMEIIDEEWRKDKLPMEDIQVPEMELPEPEPDNGPSSETLKEQEAKWMDLALSTLHDQQASSTSH |
|