Gene
| Gene Model ID | pfu_aug2.0_240.1_00480 |
|---|---|
| Locus | scaffold240.1 : 124826 ... 145055 : + |
| To GenomeBrowser | scaffold240.1:124826..145055 |
| Genes list of scaffold | scaffold240.1 |
| Synonym | pfu_aug1.0_4310.1_08864 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| n-alpha-acetyltransferase 20 | GO:0008080 GO:0008152 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_240.1_00480.t1 | 1 | 1 | Acetyltransf_1 | 11 | 69 | 4.2e-13 | 49.1 | 2.3e-16 | 5.6e-13 | 48.7 |
| pfu_aug2.0_240.1_00480.t1 | 1 | 1 | FR47 | 13 | 73 | 4.1e-09 | 36.0 | 2.2e-12 | 5.5e-09 | 35.6 |
| pfu_aug2.0_240.1_00480.t1 | 1 | 1 | Acetyltransf_7 | 14 | 69 | 6.1e-06 | 26.3 | 3.3e-09 | 8.0e-06 | 25.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_240.1_00480.t1 | gi|676429884|ref|XP_009045746.1| | hypothetical protein LOTGIDRAFT_199122 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_240.1_00480.t1 | gi|524892493|ref|XP_005102774.1| | PREDICTED: N-alpha-acetyltransferase 20-like isoform X1 [Aplysia californica] | 0.0 |
| pfu_aug2.0_240.1_00480.t1 | gi|752882016|ref|XP_011258636.1| | PREDICTED: N-alpha-acetyltransferase 20 [Camponotus floridanus] | 0.0 |
| pfu_aug2.0_240.1_00480.t1 | gi|260830172|ref|XP_002610035.1| | hypothetical protein BRAFLDRAFT_284784 [Branchiostoma floridae] | 0.0 |
| pfu_aug2.0_240.1_00480.t1 | gi|158301515|ref|XP_321189.4| | AGAP001878-PA [Anopheles gambiae str. PEST] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_240.1_00480.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_240.1_00480.t1 atgggtaaagctgagggcgcaggagaactgtggcatggtcatgtgacagcattgactgtagctccggaatttcggcgtct tggacttgctgccaacttgatgaaaaaccttgaagaaatttctgaaaagaagcactgttactttgtggacctgtttgtga gagtatctaataaggtggctacagacatgtacacaaagcttggctatggtgtgtacaggactgttatagaatactactct ggtgacatagatgaagatgcttatgatatgaggaaagcgctatcacgtgataaagataagaagagtatgattccgttacc acatcctgtacgtccagaggagttggattga |
|
Protein
| Protein ID | pfu_aug2.0_240.1_00480.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_240.1_00480.t1 MGKAEGAGELWHGHVTALTVAPEFRRLGLAANLMKNLEEISEKKHCYFVDLFVRVSNKVATDMYTKLGYGVYRTVIEYYS GDIDEDAYDMRKALSRDKDKKSMIPLPHPVRPEELD |
|