Gene
| Gene Model ID | pfu_aug2.0_2431.1_05532 |
|---|---|
| Locus | scaffold2431.1 : 94239 ... 97834 : - |
| To GenomeBrowser | scaffold2431.1:94239..97834 |
| Genes list of scaffold | scaffold2431.1 |
| Synonym | pfu_aug1.0_1629.1_00770 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| sestrin-1-like isoform x2 | GO:0005634 GO:1901031 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_2431.1_05532.t1 | 1 | 1 | PA26 | 10 | 113 | 0.0 | 180.4 | 0.0 | 0.0 | 180.2 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_2431.1_05532.t1 | gi|676490496|ref|XP_009065289.1| | hypothetical protein LOTGIDRAFT_155490 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_2431.1_05532.t1 | gi|380023728|ref|XP_003695664.1| | PREDICTED: sestrin homolog [Apis florea] | 0.0 |
| pfu_aug2.0_2431.1_05532.t1 | gi|665799571|ref|XP_008547709.1| | PREDICTED: sestrin homolog isoform X2 [Microplitis demolitor] | 0.0 |
| pfu_aug2.0_2431.1_05532.t1 | gi|645006296|ref|XP_008204413.1| | PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100122271 [Nasonia vitripennis] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_2431.1_05532.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2431.1_05532.t1 attgtacctgtcaatacaagcgaagatacgaatgggtgagatgacagatgttgatacaacacagtttaggatatctatat ggaattacattcattgtctttacggaataatgcatgatgactacaattatcatacggtgaatcaattattagagcgaagc cttaaggcatatataaaaactgtgacctgttaccccgaaagacttacgaaaaaggattacgacagtgtcatgaaaggctt caaacacagcgaaaaggtccatgttaacctgatgctgctagaggccagattacaaggagagctgctgtacgcactacgag cggtaatgcagtacatgacataa |
|
Protein
| Protein ID | pfu_aug2.0_2431.1_05532.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_2431.1_05532.t1 LYLSIQAKIRMGEMTDVDTTQFRISIWNYIHCLYGIMHDDYNYHTVNQLLERSLKAYIKTVTCYPERLTKKDYDSVMKGF KHSEKVHVNLMLLEARLQGELLYALRAVMQYMT |
|